RTCD1 Antibody - BSA Free

Western Blot: RTCD1 Antibody [NBP2-58714] - Analysis using Anti-RTCA antibody NBP2-58714 (A) shows similar pattern to independent antibody NBP1-87113 (B).

Immunocytochemistry/Immunofluorescence: RTCD1 Antibody [NBP2-58714] - Staining of human cell line Hep G2 shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RTCD1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLANLRHGGTVDEYLQDQLIVFMALANGVSRIKTGPVTLHTQTAIHFAEQIAKAKFIVKKSEDEEDAAKDTYIIECQGIGMTNPNL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RTCA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RTCD1 Recombinant Protein Antigen (NBP2-58714PEP)

Reactivity Notes

Mouse 87%, Rat 87%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RTCD1 Antibody - BSA Free

• phosphate cyclase
• RNA 3'-terminal phosphate cyclase
• RNA cyclase
• RNA terminal phosphate cyclase domain 1
• RNA terminal phosphate cyclase domain-containing protein 1
• RNA-3'-phosphate cyclase
• RPC1
• RPCEC 6.5.1.4
• RTC domain containing 1
• RTC domain-containing protein 1
• RTC1

Background

RNA 3-prime-terminal phosphate cyclase (RPC; EC 6.5.1.4) catalyzes the ATP-dependent conversion of a 3-prime phosphate to a 2-prime,3-prime-cyclic phosphodiester at the end of RNA (Genschik et al., 1997 [PubMed 9184239]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RTCA