CRCP Antibody

Images

 
Western Blot: CRCP Antibody [NBP1-84495] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 10. Lane 2: Human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: CRCP Antibody [NBP1-84495] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies.
Immunohistochemistry-Paraffin: CRCP Antibody [NBP1-84495] - Staining of human testis shows cytoplasmic and nuclear positivity of cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRCP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRCP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CRCP Protein (NBP1-84495PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CRCP Antibody

  • Calcitonin gene-related peptide-receptor component protein
  • CGRP receptor component
  • CGRPRCP
  • CGRP-RCPRNA polymerase III subunit C9
  • CGRP-receptor component protein
  • DNA-directed RNA polymerase III subunit RPC9
  • hsC17
  • RCP9
  • RCPMGC111194

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS6731
Species: Hu, Rt, Po, Bv, Ca, Eq, Gt, Ha, Mk, Pm, Rb, Xp
Applications: IHC-P
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF6428
Species: Hu
Applications: WB, IHC
NBP2-52546
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2898
Species: Mu
Applications: WB, IP
NBP1-80732
Species: Hu
Applications: IHC, IHC-P
NBP1-92311
Species: Hu
Applications: IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB110-74730
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81855
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
21890002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-91937
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01853
Species: Hu, Mk
Applications: WB, Flow, IHC, IHC-P
NB100-40840
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
NBP1-31682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CRCP Antibody (NBP1-84495) (0)

There are no publications for CRCP Antibody (NBP1-84495).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRCP Antibody (NBP1-84495) (0)

There are no reviews for CRCP Antibody (NBP1-84495). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CRCP Antibody (NBP1-84495) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRCP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRCP
Entrez
Uniprot