POLR3B Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: POLR3B Antibody [NBP1-84628] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: POLR3B Antibody [NBP1-84628] - Staining of human rectum shows strong nuclear/ or nucleolar positivity in glandular cells.

ChIP-Exo-Seq composite graph for Anti-POLR3B (NBP1-84628) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

POLR3B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit POLR3B Antibody - BSA Free (NBP1-84628) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VEADRKGAVGASVTSSTHEKKSRTNMAVKQGRFYLRHNTLSEDIPIVIIFKAMGVESDQEIVQMIGTEEHVMAAFGPSLEECQKAQIFTQMQ
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POLR3B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  POLR3B Protein (NBP1-84628PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for POLR3B Antibody - BSA Free

• C128
• DKFZp686B10117
• DNA-directed RNA polymerase III 127.6 kDa polypeptide
• DNA-directed RNA polymerase III subunit B
• DNA-directed RNA polymerase III subunit RPC2
• EC 2.7.7.6
• FLJ10388
• polymerase (RNA) III (DNA directed) polypeptide B
• RNA polymerase III subunit C2
• RPC2

Background

RPC2 is the second largest subunit of the 17 subunits that make up RNA polymerase III. RNA polymerase III is responsible for the synthesis of small RNA components that are part of the machinery involved in pre-mRNA splicing, and tRNA processing. Alternative names for RPC2 include DNA-directed RNA polymerase III subunit RPC2, RNA polymerase III subunit C2, DNA-directed RNA polymerase III subunit B, DNA-directed RNA polymerase III 127.6 kDa polypeptide, C128, POLR3B, and FLJ10388.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POLR3B