POLR3B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: POLR3B Antibody [NBP1-84628] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: POLR3B Antibody [NBP1-84628] - Staining of human rectum shows strong nuclear/ or nucleolar positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

POLR3B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VEADRKGAVGASVTSSTHEKKSRTNMAVKQGRFYLRHNTLSEDIPIVIIFKAMGVESDQEIVQMIGTEEHVMAAFGPSLEECQKAQIFTQMQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLR3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
POLR3B Protein (NBP1-84628PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for POLR3B Antibody

  • C128
  • DKFZp686B10117
  • DNA-directed RNA polymerase III 127.6 kDa polypeptide
  • DNA-directed RNA polymerase III subunit B
  • DNA-directed RNA polymerase III subunit RPC2
  • EC 2.7.7.6
  • FLJ10388
  • polymerase (RNA) III (DNA directed) polypeptide B
  • RNA polymerase III subunit C2
  • RPC2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83204
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87113
Species: Hu, Mu, Rt, Dr
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-84621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49530
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-80815
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-53092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009533-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-47329
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-14254
Species: Hu, Mu
Applications: WB, IHC
NBP2-19885
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00482
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-80816
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84628
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for POLR3B Antibody (NBP1-84628) (0)

There are no publications for POLR3B Antibody (NBP1-84628).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR3B Antibody (NBP1-84628) (0)

There are no reviews for POLR3B Antibody (NBP1-84628). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for POLR3B Antibody (NBP1-84628) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POLR3B Products

Bioinformatics Tool for POLR3B Antibody (NBP1-84628)

Discover related pathways, diseases and genes to POLR3B Antibody (NBP1-84628). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLR3B Antibody (NBP1-84628)

Discover more about diseases related to POLR3B Antibody (NBP1-84628).
 

Pathways for POLR3B Antibody (NBP1-84628)

View related products by pathway.

PTMs for POLR3B Antibody (NBP1-84628)

Learn more about PTMs related to POLR3B Antibody (NBP1-84628).

Blogs on POLR3B

There are no specific blogs for POLR3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLR3B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR3B