POLR3B Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: POLR3B Antibody [NBP1-84628] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: POLR3B Antibody [NBP1-84628] - Staining of human rectum shows strong nuclear/ or nucleolar positivity in glandular cells.
ChIP-Exo-Seq composite graph for Anti-POLR3B (NBP1-84628) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, ChIP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

POLR3B Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit POLR3B Antibody - BSA Free (NBP1-84628) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VEADRKGAVGASVTSSTHEKKSRTNMAVKQGRFYLRHNTLSEDIPIVIIFKAMGVESDQEIVQMIGTEEHVMAAFGPSLEECQKAQIFTQMQ
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLR3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
POLR3B Protein (NBP1-84628PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for POLR3B Antibody - BSA Free

  • C128
  • DKFZp686B10117
  • DNA-directed RNA polymerase III 127.6 kDa polypeptide
  • DNA-directed RNA polymerase III subunit B
  • DNA-directed RNA polymerase III subunit RPC2
  • EC 2.7.7.6
  • FLJ10388
  • polymerase (RNA) III (DNA directed) polypeptide B
  • RNA polymerase III subunit C2
  • RPC2

Background

RPC2 is the second largest subunit of the 17 subunits that make up RNA polymerase III. RNA polymerase III is responsible for the synthesis of small RNA components that are part of the machinery involved in pre-mRNA splicing, and tRNA processing. Alternative names for RPC2 include DNA-directed RNA polymerase III subunit RPC2, RNA polymerase III subunit C2, DNA-directed RNA polymerase III subunit B, DNA-directed RNA polymerase III 127.6 kDa polypeptide, C128, POLR3B, and FLJ10388.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83204
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, WB
NBP1-87113
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-84621
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-49530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-46938
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP2-53092
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
H00080279-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
H00009533-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
664-LI
Species: Hu
Applications: BA
NBP2-47329
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP1-82655
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB500-174
Species: Hu, Ma, Mar, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
H00001392-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-93863
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-80818
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-00482
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-80816
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-84628
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, ChIP

Publications for POLR3B Antibody (NBP1-84628) (0)

There are no publications for POLR3B Antibody (NBP1-84628).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR3B Antibody (NBP1-84628) (0)

There are no reviews for POLR3B Antibody (NBP1-84628). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for POLR3B Antibody (NBP1-84628) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLR3B Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR3B