RTCD1 Antibody - BSA Free

Western Blot: RTCD1 Antibody [NBP1-87113] - Analysis using Anti-RTCA antibody NBP1-87113 (A) shows similar pattern to independent antibody NBP2-58714 (B).

Immunocytochemistry/Immunofluorescence: RTCD1 Antibody [NBP1-87113] - Staining of human cell line A-431 shows localization to nucleus.

Immunohistochemistry-Paraffin: RTCD1 Antibody [NBP1-87113] - Staining of human kidney shows moderate nuclear and cytoplasmic positivity in cells in tubules.

Western Blot: RTCD1 Antibody [NBP1-87113] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

• Reactivity: Hu, Mu, Rt, Dr
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RTCD1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LFAASPSELHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNPINLTERGCVTKIY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RTCA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC, WB reported in scientific literature (PMID: 25961792). For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
• Control Peptide:

  RTCD1 Protein (NBP1-87113PEP)

Reactivity Notes

Drosophila reactivity reported in scientific literature (PMID: 25961792).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RTCD1 Antibody - BSA Free

• phosphate cyclase
• RNA 3'-terminal phosphate cyclase
• RNA cyclase
• RNA terminal phosphate cyclase domain 1
• RNA terminal phosphate cyclase domain-containing protein 1
• RNA-3'-phosphate cyclase
• RPC1
• RPCEC 6.5.1.4
• RTC domain containing 1
• RTC domain-containing protein 1
• RTC1

Background

RNA 3-prime-terminal phosphate cyclase (RPC; EC 6.5.1.4) catalyzes the ATP-dependent conversion of a 3-prime phosphate to a 2-prime,3-prime-cyclic phosphodiester at the end of RNA (Genschik et al., 1997 [PubMed 9184239]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RTCD1 Antibody (NBP1-87113)(1)

Publication using NBP1-87113

• Song Y, Sretavan D, Salegio EA et al. Regulation of axon regeneration by the RNA repair/splicing pathway. Nat Neurosci 2015-06-01 [PMID: 25961792] (WB, IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: RTCA