RTCD1 Antibody

Images

 
Western Blot: RTCD1 Antibody [NBP1-87113] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: RTCD1 Antibody [NBP1-87113] - Staining of human kidney shows moderate nuclear and cytoplasmic positivity in cells in tubules.
Western Blot: RTCD1 Antibody [NBP1-87113] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, Rt, DrSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RTCD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LFAASPSELHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNPINLTERGCVTKIY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RTCA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
RTCD1 Protein (NBP1-87113PEP)
Publications
Read Publication using
NBP1-87113 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Drosophila reactivity reported in scientific literature (PMID: 25961792).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RTCD1 Antibody

  • phosphate cyclase
  • RNA 3'-terminal phosphate cyclase
  • RNA cyclase
  • RNA terminal phosphate cyclase domain 1
  • RNA terminal phosphate cyclase domain-containing protein 1
  • RNA-3'-phosphate cyclase
  • RPC1
  • RPCEC 6.5.1.4
  • RTC domain containing 1
  • RTC domain-containing protein 1
  • RTC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84628
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
AF1936
Species: Hu
Applications: WB, IP
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
7570-GH
Species: Hu
NBP2-52546
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-84495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP1-87113
Species: Hu, Mu, Rt, Dr
Applications: WB, IHC, IHC-P

Publications for RTCD1 Antibody (NBP1-87113)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for RTCD1 Antibody (NBP1-87113) (0)

There are no reviews for RTCD1 Antibody (NBP1-87113). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RTCD1 Antibody (NBP1-87113) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RTCD1 Products

Bioinformatics Tool for RTCD1 Antibody (NBP1-87113)

Discover related pathways, diseases and genes to RTCD1 Antibody (NBP1-87113). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RTCD1 Antibody (NBP1-87113)

Discover more about diseases related to RTCD1 Antibody (NBP1-87113).
 

Pathways for RTCD1 Antibody (NBP1-87113)

View related products by pathway.

PTMs for RTCD1 Antibody (NBP1-87113)

Learn more about PTMs related to RTCD1 Antibody (NBP1-87113).

Blogs on RTCD1

There are no specific blogs for RTCD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RTCD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RTCA