RTCD1 Antibody

Images

 
Immunohistochemistry: RTCD1 Antibody [NBP1-87112] - Staining of human testis shows strong cytoplasmic positivity in leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RTCD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PLRVQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIKGGIHTADTKTAGSVCLLMQVSMPCV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RTCA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RTCD1 Protein (NBP1-87112PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RTCD1 Antibody

  • phosphate cyclase
  • RNA 3'-terminal phosphate cyclase
  • RNA cyclase
  • RNA terminal phosphate cyclase domain 1
  • RNA terminal phosphate cyclase domain-containing protein 1
  • RNA-3'-phosphate cyclase
  • RPC1
  • RPCEC 6.5.1.4
  • RTC domain containing 1
  • RTC domain-containing protein 1
  • RTC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84628
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
AF1936
Species: Hu
Applications: WB, IP
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
7570-GH
Species: Hu
NBP2-52546
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-84495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP1-87112
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for RTCD1 Antibody (NBP1-87112) (0)

There are no publications for RTCD1 Antibody (NBP1-87112).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RTCD1 Antibody (NBP1-87112) (0)

There are no reviews for RTCD1 Antibody (NBP1-87112). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RTCD1 Antibody (NBP1-87112) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RTCD1 Products

Bioinformatics Tool for RTCD1 Antibody (NBP1-87112)

Discover related pathways, diseases and genes to RTCD1 Antibody (NBP1-87112). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RTCD1 Antibody (NBP1-87112)

Discover more about diseases related to RTCD1 Antibody (NBP1-87112).
 

Pathways for RTCD1 Antibody (NBP1-87112)

View related products by pathway.

PTMs for RTCD1 Antibody (NBP1-87112)

Learn more about PTMs related to RTCD1 Antibody (NBP1-87112).

Blogs on RTCD1

There are no specific blogs for RTCD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RTCD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RTCA