RRM1 Antibody - BSA Free

Immunohistochemistry-Paraffin: RRM1 Antibody [NBP2-49415] - Staining of human tonsil shows cytoplasmic positivity in germinal center.

PDAC PDX models of acquired gemcitabine resistance harbored changes in expression of some gemcitabine transporters & metabolizing enzymes. Tumor tissue harvested on days 190, 120, & 179 for PA4.gemR, PA10.gemR & PA16.gemR, respectively, was immunostained for RRM1, RRM2, hCNT1, hENT1, CDA, & dCK. Tumor tissue harvested from control mice bearing gemcitabine-naïve PA4, PA10 or PA16 tumors served as controls for IHC staining experiments. Scale bar = 10 μm. Quantitation of IHC data in A is shown as expression indices below each photomicrograph (A); protein expression in gemR models that were developed by exposure to drug in vivo, compared to their respective parent tumor models. Each protein has been reported to be associated with gemcitabine resistance in models developed in vitro. ND: no difference between gemcitabine-naïve control & gemR tumors. Values in the Table were calculated by dividing the EI of each protein determined by IHC expressed by gemR/parent (control) tumors. A change of > 1.5-fold was interpreted as a real increase or decrease (B). PDAC: pancreatic ductal adenocarcinoma; PDX: patient-derived xenograft; gemR: gemcitabine resistance; IHC: immunohistochemistry Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33073205), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RRM1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RRM1 Antibody - BSA Free (NBP2-49415) is a polyclonal antibody validated for use in IHC and WB. Anti-RRM1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDR
• Predicted Species: Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RRM1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RRM1 Recombinant Protein Antigen (NBP2-49415PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RRM1 Antibody - BSA Free

• EC 1.17.4.1
• R1
• ribonucleoside-diphosphate reductase large subunit
• Ribonucleoside-diphosphate reductase subunit M1
• Ribonucleotide reductase large subunit
• ribonucleotide reductase M1 polypeptide
• ribonucleotide reductase M1
• ribonucleotide reductase, large subunit
• ribonucleotide reductase, R1 subunit
• RIR1
• RR1
• RRM1

Background

RRM1 - ribonucleotide reductase M1 polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RRM1 Antibody (NBP2-49415)(1)

Publication using NBP2-49415

• Miller, A L, Garcia, P L Et al. Development of gemcitabine-resistant patient-derived xenograft models of pancreatic ductal adenocarcinoma. Cancer Drug Resist 2020-10-20 [PMID: 33073205] (WB, Mouse)

Bioinformatics

• Gene Symbol: RRM1