CD82/Kai-1 Antibody (0T3L6) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 168-267 of human CD82/Kai-1 (P27701). PEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
CD82 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 1:50 - 1:200
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for CD82/Kai-1 Antibody (0T3L6)
Background
Kangai 1 is a leukocyte surface glycoprotein with metastasis/tumor suppressor activity. It inhibits the progression of prostate, breast, lung, bladder, pancreatic and hepatocellular carcinomas. Lower levels of Kangai 1 gene expression correlate with the malignant development of cancers.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Eq, Gt, Sh
Applications: Flow, IHC, IHC-Fr, IP
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Ca, Hu
Applications: Flow, IHC, IHC-Fr
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, In vitro, WB
Species: Hu
Applications: ELISA
Species: Ca, Hu
Applications: B/N, DB, EM, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC-WhMt, IP, In vitro, WB
Species: Gt, Hu, Mu, Pm, Sh
Applications: CyTOF-ready, DB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: ELISA
Species: Hu
Applications: DirELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IP, WB
Publications for CD82/Kai-1 Antibody (NBP3-16797) (0)
There are no publications for CD82/Kai-1 Antibody (NBP3-16797).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD82/Kai-1 Antibody (NBP3-16797) (0)
There are no reviews for CD82/Kai-1 Antibody (NBP3-16797).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CD82/Kai-1 Antibody (NBP3-16797) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CD82/Kai-1 Products
Diseases for CD82/Kai-1 Antibody (NBP3-16797)
Discover more about diseases related to CD82/Kai-1 Antibody (NBP3-16797).
| | Pathways for CD82/Kai-1 Antibody (NBP3-16797)
View related products by pathway.
|
PTMs for CD82/Kai-1 Antibody (NBP3-16797)
Learn more about PTMs related to CD82/Kai-1 Antibody (NBP3-16797).
| | Research Areas for CD82/Kai-1 Antibody (NBP3-16797)
Find related products by research area.
|
Blogs on CD82/Kai-1