CD82/Kai-1 Antibody (0T3L6) Summary
| Description |
Novus Biologicals Rabbit CD82/Kai-1 Antibody (0T3L6) (NBP3-16797) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 168-267 of human CD82/Kai-1 (P27701). PEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
CD82 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
- Immunocytochemistry/ Immunofluorescence 1:200 - 1:2000
- Immunohistochemistry 1:100 - 1:500
- Immunohistochemistry-Paraffin 1:100 - 1:500
- Western Blot 1:1000 - 1:6000
|
| Theoretical MW |
30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CD82/Kai-1 Antibody (0T3L6)
Background
Kangai 1 is a leukocyte surface glycoprotein with metastasis/tumor suppressor activity. It inhibits the progression of prostate, breast, lung, bladder, pancreatic and hepatocellular carcinomas. Lower levels of Kangai 1 gene expression correlate with the malignant development of cancers.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Flow, IF, IHC, IHC-Fr
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, In vitro, WB
Species: Mu
Applications: ELISA
Species: Ca, Hu
Applications: B/N, DB, EM, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC-WhMt, IP, In vitro, WB
Species: Gt, Hu, Mu, Pm, Sh
Applications: CyTOF-ready, DB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA
Species: Hu
Applications: DirELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IP, WB
Publications for CD82/Kai-1 Antibody (NBP3-16797) (0)
There are no publications for CD82/Kai-1 Antibody (NBP3-16797).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD82/Kai-1 Antibody (NBP3-16797) (0)
There are no reviews for CD82/Kai-1 Antibody (NBP3-16797).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CD82/Kai-1 Antibody (NBP3-16797) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CD82/Kai-1 Products
Research Areas for CD82/Kai-1 Antibody (NBP3-16797)
Find related products by research area.
|
Blogs on CD82/Kai-1