CD82/Kai-1 Antibody (0T3L6)

Western Blot: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Analysis of extracts of various cell lines, using CD82/Kai-1 Rabbit mAb (NBP3-16797) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry-Paraffin: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] -Human tonsil tissue using CD82 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunocytochemistry/Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Confocal imaging of RAW 264.7 cells using CD82 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) ( dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Confocal imaging of Raji cells using CD82 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Confocal imaging of paraffin-embedded Human breast cancer using CD82 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunocytochemistry/ Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Confocal imaging of paraffin-embedded Human breast cancer using CD82/Kai-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunocytochemistry/ Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Confocal imaging of Raji cells using CD82/Kai-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Confocal imaging of RAW 264.7 cells using CD82/Kai-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [CD82/Kai-1] - Confocal imaging of paraffin-embedded Human breast cancer using CD82/Kai-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunocytochemistry/ Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [CD82/Kai-1] - Confocal imaging of Raji cells using CD82/Kai-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [CD82/Kai-1] - Confocal imaging of RAW 264.7 cells using CD82/Kai-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 0T3L6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CD82/Kai-1 Antibody (0T3L6) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 168-267 of human CD82/Kai-1 (P27701). PEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CD82
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:200 - 1:2000
  • Immunohistochemistry 1:100 - 1:500
  • Immunohistochemistry-Paraffin 1:100 - 1:500
  • Western Blot 1:1000 - 1:6000
• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CD82/Kai-1 Antibody (0T3L6)

• CD82 antigenC33
• CD82 molecule
• CD82
• IA4
• IA4C33 antigen
• Inducible membrane protein R2
• KAI1
• KAI1GR15
• kangai 1 (suppression of tumorigenicity 6, prostate; CD82 antigen (R2 leukocyteantigen, antigen detected by monoclonal and IA4))
• Metastasis suppressor Kangai-1
• R2
• SAR2
• SAR2tetraspanin-27
• ST6
• ST6tspan-27
• Suppressor of tumorigenicity 6 protein
• Tetraspanin-27
• TSPAN27
• Tspan-27
• TSPAN274F9

Background

Kangai 1 is a leukocyte surface glycoprotein with metastasis/tumor suppressor activity. It inhibits the progression of prostate, breast, lung, bladder, pancreatic and hepatocellular carcinomas. Lower levels of Kangai 1 gene expression correlate with the malignant development of cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD82