CD82/Kai-1 Antibody (0T3L6)

Western Blot: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Analysis of extracts of various cell lines, using CD82/Kai-1 Rabbit mAb (NBP3-16797) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Immunofluorescence analysis of Raw264 7 cells using CD82/Kai-1 Rabbit mAb (NBP3-16797) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Human colon using CD82/Kai-1 Rabbit mAb (NBP3-16797) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunocytochemistry/Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Immunofluorescence analysis of Jurkat cells using CD82/Kai-1 Rabbit mAb (NBP3-16797) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clone: 0T3L6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CD82/Kai-1 Antibody (0T3L6) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 168-267 of human CD82/Kai-1 (P27701). PEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CD82
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CD82/Kai-1 Antibody (0T3L6)

• CD82 antigenC33
• CD82 molecule
• CD82
• IA4
• IA4C33 antigen
• Inducible membrane protein R2
• KAI1
• KAI1GR15
• kangai 1 (suppression of tumorigenicity 6, prostate; CD82 antigen (R2 leukocyteantigen, antigen detected by monoclonal and IA4))
• Metastasis suppressor Kangai-1
• R2
• SAR2
• SAR2tetraspanin-27
• ST6
• ST6tspan-27
• Suppressor of tumorigenicity 6 protein
• Tetraspanin-27
• TSPAN27
• Tspan-27
• TSPAN274F9

Background

Kangai 1 is a leukocyte surface glycoprotein with metastasis/tumor suppressor activity. It inhibits the progression of prostate, breast, lung, bladder, pancreatic and hepatocellular carcinomas. Lower levels of Kangai 1 gene expression correlate with the malignant development of cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD82