Home » RPL13A » RPL13A Antibodies » RPL13A Antibody

RPL13A Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: RPL13A Antibody [NBP2-88184] - Host: Rabbit. Target Name: RPL13A. Sample Tissue: Human NCI-H226 Whole Cell lysates. Antibody Dilution: 1ug/ml
Western Blot: RPL13A Antibody [NBP2-88184] - Host: Rabbit. Target Name: RPL13A. Sample Tissue: Human NCI-H226 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

RPL13A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RPL13A. Peptide sequence: YLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLK The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RPL13A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPL13A Antibody

  • 60S ribosomal protein L13a
  • ribosomal protein L13a
  • tissue specific transplantation antigen 1,23 kDa highly basic protein
  • TSTA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

GAPDH Antibody
(1D4)
NB300-221
Western Blot: GAPDH Antibody (1D4) [NB300-221] - Analysis of cell line lysates probed with mouse mAb to GAPDH (theoretical molecular weight: 36 kDa), NB300-221, dilution 1:2,000: [1] protein standard, [2] HEK293, [3] HeLa, [4] SH-SY5Y, [5] COS1, [6] NIH-3T3, and [7] C6 cells. The GAPDH antibody reveals a single band at ~37 kDa in all cell lines. GAPDH is a house keeping protein, the level of which is relatively unaffected by most experimental manipulations, and, as a result, this antibody has been widely used as a western blotting loading control.
Immunocytochemistry/Immunofluorescence: GAPDH Antibody (1D4) [NB300-221] - Analysis of of HeLa cells stained with GAPDH antibody, dilution 1:100 (Green). DAPI staining of nuclear DNA (Blue). The GAPDHantibody produces strong cytoplasmic staining of healthy cells.
Immunocytochemistry/Immunofluorescence: GAPDH Antibody (1D4) [NB300-221] - SH-SY5Y cells stained with GAPDH antibody NB300-221 (green). Nuclear DNA is stained with Hoechst dye (blue).
(19 Reviews)
(358 Publications)
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
beta-Actin
Antibody (AC-15)
NB600-501
Western Blot: beta-Actin Antibody (AC-15) [NB600-501] - HEK293T cells transfected with Niaph virus Matrix Protein, expression 24h later. This image was submitted via customer review.
Simple Western: beta-Actin Antibody (AC-15) [NB600-501] - Analysis using the HRP conjugate of NB600-501. Image shows a specific band for Beta-Actin in 0.2 mg/mL of Hela, MCF-7, SH-SY5Y, & Jurkat lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
Simple Western: beta-Actin Antibody (AC-15) [NB600-501] - Analysis using the HRP conjugate of NB600-501. Electropherogram image(s) of corresponding Simple Western lane view. Beta-Actin antibody was used at 1:500 dilution on Hela, MCF-7, SH-SY5Y, & Jurkat lysate(s).
(27 Reviews)
(503 Publications)
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Actin Gamma 1
Antibody
NB600-533
Western Blot: Actin Gamma 1 Antibody [NB600-533] - Detection of human and mouse Cytoskeletal Actin by western blot. Samples: Whole cell lysate (15 ug) from HeLa, HEK293T, Jurkat, mouse TCMK-1, and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-Cytoskeletal Actin antibody NB600-533 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Western Blot: Actin Gamma 1 Antibody [NB600-533] - Whole cell lysate from HeLa (1, 2.5, 5, 15 and 50 ug) and mouse NIH3T3 cells (50 ug), probed with diluted at 0.04 ug/ml.
Western Blot: Actin Gamma 1 Antibody [NB600-533] - Knockdown of DLK in differentiated Neuro-2a cells. Neuro-2a cells were infected with an empty lentiviral vector (pLKO.1) or with lentivirus expressing mouse DLK shRNAs (sh73 and sh69). After infection and selection with puromycin, cells were subjected to differentiation for 24 h before being processed for total RNA extraction and whole-cell extracts. Representative Western blots showing levels of DLK, phospho-JNK (p-JNK), total JNK, phospho-c-Jun (p-c-Jun) and actin in infected Neuro-2a cells. Image collected and cropped by CiteAb from the following publication (http://neuraldevelopment.biomedcentral.com/articles/10.1186/s13064-016-0068-8), licensed under a CC-BY licence.
(6 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
TATA binding
protein TBP Antibody
NBP3-13174
Western Blot: TATA binding protein TBP Antibody [NBP3-13174] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with TATA binding protein TBP antibody (NBP3-13174) diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: TATA binding protein TBP Antibody [NBP3-13174] - TATA binding protein TBP antibody detects TATA binding protein TBP protein at nucleus by immunohistochemical analysis. Sample: Paraffin-embedded mouse testis. TATA binding protein TBP stained by TATA binding protein TBP antibody (NBP3-13174) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunohistochemistry-Paraffin: TATA binding protein TBP Antibody [NBP3-13174] - TATA binding protein TBP antibody detects TATA binding protein TBP protein at nucleus by immunohistochemical analysis. Sample: Paraffin-embedded mouse ovary. TATA binding protein TBP stained by TATA binding protein TBP antibody (NBP3-13174) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
SDHA Antibody
(JM10-83)
NBP2-67130
Immunocytochemistry/Immunofluorescence: SDHA Antibody (JM10-83) [NBP2-67130] - Staining SDHA in HepG2 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: SDHA Antibody (JM10-83) [NBP2-67130] - Staining SDHA in MCF-7 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: SDHA Antibody (JM10-83) [NBP2-67130] - Analysis of paraffin-embedded human kidney tissue using anti-SDHA antibody. Counter stained with hematoxylin.
(1 Review)
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
14-3-3 zeta
Antibody (818515) [Un ...
MAB2669
Simple Western lane view shows lysates of SH‑SY5Y human neuroblastoma cell line, loaded at 0.5 mg/mL. A specific band was detected for 14‑3‑3 zeta at approximately 34 kDa (as indicated) using 2 µg/mL of Mouse Anti-Human 14‑3‑3 zeta Monoclonal Antibody (Catalog # MAB2669). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of SH‑SY5Y human neuroblastoma cell line,SK‑Mel‑28 human malignant melanoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, and C6 rat glioma cell line. PVDF membrane was probed with 0.2 µg/mL of Mouse Anti-Human14‑3‑3 zeta  Monoclonal Antibody (Catalog # MAB2669) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for14‑3‑3 zeta at approximately 27 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
14‑3‑3 zeta  was detected in immersion fixed paraffin-embedded sections of human squamous cell carcinoma using Mouse Anti-Human 14‑3‑3 zeta Monoclonal Antibody (Catalog # MAB2669) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to nuclei and plasma membrane. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
Species: Hu
Applications: IHC, Simple Western, WB
HPRT Antibody
NBP1-33527
Western Blot: HPRT Antibody [NBP1-33527] - Wild-type (WT) and HPRT knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with HPRT antibody diluted at 1:2000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Western Blot: HPRT Antibody [NBP1-33527] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with HPRT antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunohistochemistry-Paraffin: HPRT Antibody [NBP1-33527] - Paraffin-embedded human endometrial cancer. HPRT antibody) diluted at 1:500.
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
beta
2-Microglobulin Antib ...
NB500-317
Western Blot: beta 2-Microglobulin Antibody (B2M-01) [NB500-317] - Analysis using the FITC conjugate of NB500-317. Detection (non-reducing conditions) of whole cell lysate of various cell lines Lane 1: RAJI human Burkitt lymphoma cell line Lane 2: EL4 mouse lymphoblastic lymphoma cell line Lane 3: U937 human histiocytic lymphoma cell line.
Flow Cytometry: beta 2-Microglobulin Antibody (B2M-01) [NB500-317] - Staining of beta-2-microglobulin in human peripheral blood with anti-beta-2-microglobulin (B2M-01) biotin.
ELISA: beta 2-Microglobulin Antibody (B2M-01) [NB500-317] - Analysis of HLA-G and beta2-microglobulin in supernatant of HLA-G transfectants with anti-beta2-microglobulin (B2M-01) HRP as the detection antibody. Image using the HRP format of this antibody.
(1 Review)
(2 Publications)
Species: Bv(-), Ca(-), Ch(-), Hu, Mu(-), Rb(-)
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA, WB
Cyclophilin A
Antibody
NBP1-30993
Western Blot: Cyclophilin A Antibody [NBP1-30993] - Analysis. Mouse tissue extracts (50 ug) was separated by 15 % SDS-PAGE, and the membrane was blotted with Cyclophilin A antibody at a dilution of 1:20000.
Western Blot: Cyclophilin A Antibody [NBP1-30993] - (30 ug of whole cell lysate) A: HepG2 12% SDS PAGE diluted at 1:3000
Knockdown Validated: Cyclophilin A Antibody [NBP1-30993] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with Cyclophilin A antibody diluted at 1:20000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
(1 Publication)
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
PGK1 Antibody
NBP2-19784
Western Blot: PGK1 Antibody [NBP2-19784] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with PGK1 antibody diluted at 1:3000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: PGK1 Antibody [NBP2-19784] - Analysis of methanol-fixed HeLa, using antibody at 1:50 dilution.
Immunohistochemistry-Paraffin: PGK1 Antibody [NBP2-19784] - Analysis of paraffin-embedded hepatoma, using antibody at 1:500 dilution.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, WB

beta-Glucuronidase/GUS
NBP1-87511
Immunocytochemistry/Immunofluorescence: beta-Glucuronidase/GUSB Antibody [NBP1-87511] - staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: beta-Glucuronidase/GUSB Antibody [NBP1-87511] - Analysis in human liver and skeletal muscle tissues using NBP1-87511 antibody. Corresponding GUSB RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: beta-Glucuronidase/GUSB Antibody [NBP1-87511] - Staining of human liver shows strong positivity in lysosomes in hepatocytes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
beta-Actin
Antibody (AC-15)
NB600-501
Western Blot: beta-Actin Antibody (AC-15) [NB600-501] - HEK293T cells transfected with Niaph virus Matrix Protein, expression 24h later. This image was submitted via customer review.
Simple Western: beta-Actin Antibody (AC-15) [NB600-501] - Analysis using the HRP conjugate of NB600-501. Image shows a specific band for Beta-Actin in 0.2 mg/mL of Hela, MCF-7, SH-SY5Y, & Jurkat lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
Simple Western: beta-Actin Antibody (AC-15) [NB600-501] - Analysis using the HRP conjugate of NB600-501. Electropherogram image(s) of corresponding Simple Western lane view. Beta-Actin antibody was used at 1:500 dilution on Hela, MCF-7, SH-SY5Y, & Jurkat lysate(s).
(27 Reviews)
(503 Publications)
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
HMBS Antibody
NBP2-33600
Immunohistochemistry-Paraffin: HMBS Antibody [NBP2-33600] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: HMBS Antibody [NBP2-33600] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: HMBS Antibody [NBP2-33600] - Staining in human bone marrow and cerebral cortex tissues using anti-HMBS antibody. Corresponding HMBS RNA-seq data are presented for the same tissues.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
RPLP0 Antibody
NBP1-82859
Immunohistochemistry-Paraffin: RPLP0 Antibody [NBP1-82859] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: RPLP0 Antibody [NBP1-82859] - Staining of human skin shows weak to moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: RPLP0 Antibody [NBP1-82859] - Staining of human fallopian tube shows weak cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(719 Publications)
Species: Hu
Applications: BA
EIF3B Antibody
NB100-93302
Immunohistochemistry-Paraffin: EIF3B Antibody [NB100-93302] - FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit antiEIF3S9/eIF3B used at a dilution of 1:200 (1ug/ml). Detection: DAB
Western Blot: EIF3B Antibody [NB100-93302] - Whole cell lysate (15 ug) from HeLa, 293T, and Jurkat cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-eIF3B antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Immunoprecipitation: EIF3B Antibody [NB100-93302] - Detection of human eIF3B by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-eIF3B antibody NB100-93302 used for IP at 3 ug per reaction. eIF3B was also immunoprecipitated by another rabbit anti-eIF3B antibody. For blotting immunoprecipitated eIF3B, NB100-93302 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 seconds.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Ceruloplasmin
Antibody (6C3K9)
NBP3-15868
Immunohistochemistry-Paraffin: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Immunohistochemistry of paraffin-embedded rat liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Immunohistochemistry of paraffin-embedded human liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Immunofluorescence analysis of rat liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen: Tyrosine Hydroxylase Antibody [NB300-109] - 10x Magnification cryo-sections mouse: primary antibody: anti-rb TH: 1:500; o.n. secondary antibody: 1:500 dk-anti-rb DyLight488. IHC-Fr image submitted by a verified customer review.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the mushroom body. All panels show a right brain hemisphere (dorsal to the top, medial to the right), except panels M-O (posterior to the top). Tyrosine hydroxylase (TH) immunoreactivity is shown in magenta (A, D, G, J, M) and synapsin immunoreactivity in green (B, E, H, K, N). Corresponding merged images in C, F, I, L, O. Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the central complex and the lateral accessory lobe. A-D: Frontal sections (immunoperoxidase preparations, dorsal to the top). E: Horizontal section (immunofluorescent preparation, posterior to the top). Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
(7 Reviews)
(173 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
IL-6 [HRP]
D6050
(32 Reviews)
(644 Publications)
Species: Hu
Applications: ELISA
RPL13A Antibody
NBP2-88184
RPL13A Antibody
Species: Hu
Applications: WB

Publications for RPL13A Antibody (NBP2-88184) (0)

There are no publications for RPL13A Antibody (NBP2-88184).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL13A Antibody (NBP2-88184) (0)

There are no reviews for RPL13A Antibody (NBP2-88184). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL13A Antibody (NBP2-88184) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPL13A Products

Bioinformatics Tool for RPL13A Antibody (NBP2-88184)

Discover related pathways, diseases and genes to RPL13A Antibody (NBP2-88184). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL13A Antibody (NBP2-88184)

Discover more about diseases related to RPL13A Antibody (NBP2-88184).
 

Pathways for RPL13A Antibody (NBP2-88184)

View related products by pathway.

PTMs for RPL13A Antibody (NBP2-88184)

Learn more about PTMs related to RPL13A Antibody (NBP2-88184).
 

Research Areas for RPL13A Antibody (NBP2-88184)

Find related products by research area.

Blogs on RPL13A

There are no specific blogs for RPL13A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL13A Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RPL13A