RPL13A Antibody

Images

 
Western Blot: RPL13A Antibody [NBP2-88184] - Host: Rabbit. Target Name: RPL13A. Sample Tissue: Human NCI-H226 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPL13A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RPL13A. Peptide sequence: YLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLK The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RPL13A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPL13A Antibody

  • 60S ribosomal protein L13a
  • ribosomal protein L13a
  • tissue specific transplantation antigen 1,23 kDa highly basic protein
  • TSTA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
NB600-533
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-67130
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB2669
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-33527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB500-317
Species: Bv(-), Ca(-), Ch(-), Hu, Mu(-), Rb(-)
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA, WB
NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, WB
NBP1-87511
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
NBP2-33600
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-93302
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP3-15868
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
D6050
Species: Hu
Applications: ELISA
NBP2-88184
Species: Hu
Applications: WB

Publications for RPL13A Antibody (NBP2-88184) (0)

There are no publications for RPL13A Antibody (NBP2-88184).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL13A Antibody (NBP2-88184) (0)

There are no reviews for RPL13A Antibody (NBP2-88184). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL13A Antibody (NBP2-88184) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPL13A Products

Bioinformatics Tool for RPL13A Antibody (NBP2-88184)

Discover related pathways, diseases and genes to RPL13A Antibody (NBP2-88184). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL13A Antibody (NBP2-88184)

Discover more about diseases related to RPL13A Antibody (NBP2-88184).
 

Pathways for RPL13A Antibody (NBP2-88184)

View related products by pathway.

PTMs for RPL13A Antibody (NBP2-88184)

Learn more about PTMs related to RPL13A Antibody (NBP2-88184).
 

Research Areas for RPL13A Antibody (NBP2-88184)

Find related products by research area.

Blogs on RPL13A

There are no specific blogs for RPL13A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL13A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL13A