Reactivity | HuSpecies Glossary |
Applications | WB, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | BSA Free |
Concentration | 0.5 mg/ml |
Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen | Synthetic peptides corresponding to RPE(ribulose-5-phosphate-3-epimerase) The peptide sequence was selected from the middle region of RPE. Peptide sequence MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK. The peptide sequence for this immunogen was taken from within the described region. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | RPE |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Concentration | 0.5 mg/ml |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Using RPE65 as a tool to investigate ocular gene therapies While not life threatening, blindness and retinal disease are profoundly debilitating and greatly affect quality of life. Understandably, gene therapy has been subject to controversy given it’s potential effects on the rest of our cellular ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.