RPE Antibody


Western Blot: RPE Antibody [NBP1-56853] - Human Muscle lysate, concentration 0.2-1 ug/ml.
Immunocytochemistry/ Immunofluorescence: RPE Antibody [NBP1-56853] - Antibody 0 Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver Observed Staining: Cytoplasm but only in connective tissue cells in the ...read more

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC

Order Details

RPE Antibody Summary

Synthetic peptides corresponding to RPE(ribulose-5-phosphate-3-epimerase) The peptide sequence was selected from the middle region of RPE. Peptide sequence MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against RPE and was validated on Western blot.
RPE Lysate (NBP2-65672)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RPE Antibody

  • EC
  • MGC2636
  • Ribulose-5-phosphate-3-epimerase
  • ribulose-phosphate 3-epimerase
  • RPE2-1


The function of this protein remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IF
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RPE Antibody (NBP1-56853) (0)

There are no publications for RPE Antibody (NBP1-56853).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPE Antibody (NBP1-56853) (0)

There are no reviews for RPE Antibody (NBP1-56853). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPE Antibody (NBP1-56853) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for RPE Antibody (NBP1-56853)

Discover related pathways, diseases and genes to RPE Antibody (NBP1-56853). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPE Antibody (NBP1-56853)

Discover more about diseases related to RPE Antibody (NBP1-56853).

Pathways for RPE Antibody (NBP1-56853)

View related products by pathway.

PTMs for RPE Antibody (NBP1-56853)

Learn more about PTMs related to RPE Antibody (NBP1-56853).

Blogs on RPE.

Using RPE65 as a tool to investigate ocular gene therapies
While not life threatening, blindness and retinal disease are profoundly debilitating and greatly affect quality of life.  Understandably, gene therapy has been subject to controversy given it’s potential effects on the rest of our cellular...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RPE Antibody and receive a gift card or discount.


Gene Symbol RPE