RPA70 Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human RPA70 (NP_002936.1).
Sequence: MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNEGLGQPQVAPPAPAASPAASSRPQPQNGSSGMGSTVSKAYGASKTFGKAAGPSLSHTSGGTQSKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNE |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RPA1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin 1:50 - 1:100
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
68 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for RPA70 Antibody - BSA Free
Background
RPA (Replication protein A) is a stable heterotrimer of 70kDa, 32-34kDa, and 11-14kDa subunits (RPA70, RPA32, and RPA14 respectively). RPA is a single strand binding protein that is involved in replication, homologous recombination and nucleotide excision and repair. It colocalises with RAD51 on synapsed axes in meiosis, facilitating RAD51 function. Replication protein A acts as an auxiliary protein for DNA polymerases alpha and delta.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: WB
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: WB, ELISA, IHC
Publications for RPA70 Antibody (NBP3-35085) (0)
There are no publications for RPA70 Antibody (NBP3-35085).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RPA70 Antibody (NBP3-35085) (0)
There are no reviews for RPA70 Antibody (NBP3-35085).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RPA70 Antibody (NBP3-35085) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RPA70 Products
Research Areas for RPA70 Antibody (NBP3-35085)
Find related products by research area.
|
Blogs on RPA70