RNF36 Antibody

Images

 
Western Blot: RNF36 Antibody [NBP2-42073] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: RNF36 Antibody [NBP2-42073] - Staining human cell line U-251 MG shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry: RNF36 Antibody [NBP2-42073] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF36 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GDYVEMNDSITHLPSKVVIQDITMELHCPLCNDWFRDPLMLSCGHNFCEACIQDFWRLQAKETFCPECKMLCQYNNCTFNPVLDKLVEKIKKLPLLKGHPQCPEHGENLKLFSKPDGKLICFQCKDARLSVGQSKEFLQISDAV
Specificity
Specificity of human, rat RNF36 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM69
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RNF36 Recombinant Protein Antigen (NBP2-42073PEP)

Reactivity Notes

Rat cross reactivity determined by WB.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNF36 Antibody

  • RFP-like domain-containing protein trimless
  • RING finger protein 36HSD34
  • RNF36
  • Trif
  • TRIMLESS
  • tripartite motif containing 69
  • tripartite motif protein 69
  • tripartite motif-containing 69
  • tripartite motif-containing protein 69

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NB100-56722
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IP, B/N, Flow-CS
AF4019
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
AF4348
Species: Hu, Mu, Rt
Applications: WB, CyTOF-ready, ICC, ICFlow
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
7270-IL/CF
Species: Hu
NBP1-80669
Species: Hu
Applications: IHC, IHC-P
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-61849
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Mk, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP2-75563
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-42073
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RNF36 Antibody (NBP2-42073) (0)

There are no publications for RNF36 Antibody (NBP2-42073).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF36 Antibody (NBP2-42073) (0)

There are no reviews for RNF36 Antibody (NBP2-42073). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RNF36 Antibody (NBP2-42073) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RNF36 Antibody (NBP2-42073)

Discover related pathways, diseases and genes to RNF36 Antibody (NBP2-42073). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF36 Antibody (NBP2-42073)

Discover more about diseases related to RNF36 Antibody (NBP2-42073).
 

Pathways for RNF36 Antibody (NBP2-42073)

View related products by pathway.

PTMs for RNF36 Antibody (NBP2-42073)

Learn more about PTMs related to RNF36 Antibody (NBP2-42073).
 

Research Areas for RNF36 Antibody (NBP2-42073)

Find related products by research area.

Blogs on RNF36

There are no specific blogs for RNF36, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF36 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM69