RNF36 Antibody

Images

 
Western Blot: RNF36 Antibody [NBP1-80052] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF36 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human RNF36. Peptide sequence SIQAKTEQQNSFDFLKDITTLLHSLEQGMKVLATRELISRKLNLGQYKGP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM69
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against RNF36 and was validated on Western blot.
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RNF36 Antibody

  • RFP-like domain-containing protein trimless
  • RING finger protein 36HSD34
  • RNF36
  • Trif
  • TRIMLESS
  • tripartite motif containing 69
  • tripartite motif protein 69
  • tripartite motif-containing 69
  • tripartite motif-containing protein 69

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, B/N, Flow-IC
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NB100-56722
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, DB, ELISA, Flow, Func, ICC/IF, IP, In vitro, B/N, Flow-CS
NBP2-67741
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4348
Species: Hu, Mu, Rt
Applications: WB, CyTOF-ready, ICC, ICFlow
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC, IHC-P, KO
7270-IL/CF
Species: Hu
H00023471-P01
Species: Hu
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-45678
Species: Hu
Applications: WB, IHC, IF
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Mk, Pm
Applications: WB, Simple Western, DB, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, B/N, CyTOF-ready, Flow-IC, KD
NBP2-75563
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-80052
Species: Hu
Applications: WB

Publications for RNF36 Antibody (NBP1-80052) (0)

There are no publications for RNF36 Antibody (NBP1-80052).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF36 Antibody (NBP1-80052) (0)

There are no reviews for RNF36 Antibody (NBP1-80052). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF36 Antibody (NBP1-80052) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RNF36 Products

Bioinformatics Tool for RNF36 Antibody (NBP1-80052)

Discover related pathways, diseases and genes to RNF36 Antibody (NBP1-80052). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF36 Antibody (NBP1-80052)

Discover more about diseases related to RNF36 Antibody (NBP1-80052).
 

Pathways for RNF36 Antibody (NBP1-80052)

View related products by pathway.

PTMs for RNF36 Antibody (NBP1-80052)

Learn more about PTMs related to RNF36 Antibody (NBP1-80052).
 

Research Areas for RNF36 Antibody (NBP1-80052)

Find related products by research area.

Blogs on RNF36

There are no specific blogs for RNF36, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF36 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM69
Uniprot
COVID-19 update