MTCH1 Antibody


Western Blot: MTCH1 Antibody [NBP1-69285] - This Anti-MTCH1 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

MTCH1 Antibody Summary

Synthetic peptides corresponding to MTCH1(mitochondrial carrier homolog 1 (C. elegans)) The peptide sequence was selected from the C terminal of MTCH1. Peptide sequence NNCGLQAGLPPYSPVFKSWIHCWKYLSVQGQLFRGSSLLFRRVSSGSCFA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MTCH1 and was validated on Western blot.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
MTCH1 Lysate (NBP2-65033)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MTCH1 Antibody

  • cell proliferation-inducing protein 60
  • CGI-64
  • MGC131998
  • mitochondrial carrier homolog 1 (C. elegans)
  • mitochondrial carrier homolog 1
  • Presenilin-associated protein


MTCH1 is a potential mitochondrial transporter. It may play a role in apoptosis.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Mu
Applications: WB, IHC, Neut
Species: Mu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MTCH1 Antibody (NBP1-69285) (0)

There are no publications for MTCH1 Antibody (NBP1-69285).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTCH1 Antibody (NBP1-69285) (0)

There are no reviews for MTCH1 Antibody (NBP1-69285). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTCH1 Antibody (NBP1-69285) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional MTCH1 Products

Bioinformatics Tool for MTCH1 Antibody (NBP1-69285)

Discover related pathways, diseases and genes to MTCH1 Antibody (NBP1-69285). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTCH1 Antibody (NBP1-69285)

Discover more about diseases related to MTCH1 Antibody (NBP1-69285).

Pathways for MTCH1 Antibody (NBP1-69285)

View related products by pathway.

PTMs for MTCH1 Antibody (NBP1-69285)

Learn more about PTMs related to MTCH1 Antibody (NBP1-69285).

Research Areas for MTCH1 Antibody (NBP1-69285)

Find related products by research area.

Blogs on MTCH1

There are no specific blogs for MTCH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MTCH1 Antibody and receive a gift card or discount.


Gene Symbol MTCH1