RNA polymerase I termination factor Antibody

Images

 
Western Blot: RNA polymerase I termination factor Antibody [NBP2-38740] - Analysis in human cell line MOLT-4.
Immunocytochemistry/ Immunofluorescence: RNA polymerase I termination factor Antibody [NBP2-38740] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: RNA polymerase I termination factor Antibody [NBP2-38740] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: RNA polymerase I termination factor Antibody [NBP2-38740] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: RNA polymerase I termination factor Antibody [NBP2-38740] - Staining of human endometrium shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RNA polymerase I termination factor Antibody [NBP2-38740] - Staining of human liver shows weak nuclear positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNA polymerase I termination factor Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VKRARVSGDDFSVPSKNSESTLFDSVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPANEEHNVETAEDSEIRYLSADSGDADDSDADLGSAV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RNA polymerase I termination factor Protein (NBP2-38740PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNA polymerase I termination factor Antibody

  • RNA polymerase I termination factor
  • transcription termination factor 1
  • Transcription termination factor I
  • transcription termination factor, RNA polymerase I
  • TTF-1
  • TTF-I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-47940
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
NBP1-85571
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-77431
Species: Hu
Applications: IHC, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
NBP2-27544
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB100-355
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, In vivo, Simple Western, WB
NBP1-18885
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-32440
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, Single-Cell Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-87201
Species: Hu
Applications: IHC, IHC-P, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34594
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-85630
Species: Hu
Applications: IHC, IHC-P, WB
8184-CK
Species: Hu
Applications: EnzAct

Publications for RNA polymerase I termination factor Antibody (NBP2-38740) (0)

There are no publications for RNA polymerase I termination factor Antibody (NBP2-38740).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNA polymerase I termination factor Antibody (NBP2-38740) (0)

There are no reviews for RNA polymerase I termination factor Antibody (NBP2-38740). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RNA polymerase I termination factor Antibody (NBP2-38740) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNA polymerase I termination factor Products

Bioinformatics Tool for RNA polymerase I termination factor Antibody (NBP2-38740)

Discover related pathways, diseases and genes to RNA polymerase I termination factor Antibody (NBP2-38740). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNA polymerase I termination factor Antibody (NBP2-38740)

Discover more about diseases related to RNA polymerase I termination factor Antibody (NBP2-38740).
 

Pathways for RNA polymerase I termination factor Antibody (NBP2-38740)

View related products by pathway.

PTMs for RNA polymerase I termination factor Antibody (NBP2-38740)

Learn more about PTMs related to RNA polymerase I termination factor Antibody (NBP2-38740).

Blogs on RNA polymerase I termination factor

There are no specific blogs for RNA polymerase I termination factor, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNA polymerase I termination factor Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TTF1
Uniprot