RIOK3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RIOK3 Antibody [NBP1-86982] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & the Golgi apparatus. Antibody staining is shown in green.

Staining of human Tonsil shows strong cytoplasmic and membranous positivity in germinal and non-germinal center cells.

Staining of human Placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Staining of human Skin shows moderate cytoplasmic positivity in squamous epithelial cells.

Staining of human Rectum shows strong cytoplasmic positivity in glandular cells.

Analysis in human cell line A-431.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RIOK3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RIOK3 Antibody - BSA Free (NBP1-86982) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IPQNTISCSLADVMSEQLAKELQLEEEAAVFPEVAVAEGPFITGENIDTSSDLMLAQMLQMEYDREYDAQLRREEKKFNGDSKVSISFENYRKVHPYEDSDSSEDEVDWQDTRDDPYRPAKP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RIOK3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RIOK3 Protein (NBP1-86982PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RIOK3 Antibody - BSA Free

• DKFZp779L1370
• EC 2.7.11.1
• homolog of the Aspergillus nidulans sudD gene product
• RIO kinase 3 (yeast)
• RIO kinase 3
• serine/threonine-protein kinase RIO3
• sudD (suppressor of bimD6, Aspergillus nidulans) homolog
• sudD homolog
• sudD suppressor of bimD6 homolog
• SUDDsudD suppressor of Aspergillus nidulans bimD6 homolog

Background

RIOK3 was identified by the similarity of its product to the Aspergillus nidulans SUDD protein, an extragenic suppressor of the heat-sensitive bimD6 mutation that fails to attach properly to the spindle microtubules at a restrictive temperature. The specific function of this gene has not yet been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RIOK3