Rif1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Rif1 Antibody [NBP2-47303] - Identification of an HDR-enhancing fragment of 53BP1. Representative IF images showing HA-tagged DN1 or DN1S and RIF1 recruitment to IR-induced DNA repair foci. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-019-10735-7), licensed under a CC-BY license.

Immunohistochemistry-Paraffin: Rif1 Antibody [NBP2-47303] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.

Immunocytochemistry/Immunofluorescence: Rif1 Antibody [NBP2-47303] - Staining human cell line HEK 293 shows positivity in nucleus. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Rif1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ELNVGNEASFHGQERTKTGISEEAAIEENKRNDDSEADTAKLNAKEVATEEFNSDISLSDNTTPVKLNAQTEISEQTAAGELDGGNDVSDLHSS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RIF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Rif1 Protein (NBP2-47303PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Rif1 Antibody - BSA Free

• DKFZp434D1026
• DKFZp781N1478
• FLJ10599
• FLJ12870
• RAP1 interacting factor homolog (yeast)
• Rap1-interacting factor 1 homolog
• telomere-associated protein RIF1

Background

Rif1 (Rap1-interacting factor homolog) is a protein whose primary function is in the DNA-damage response, RIF1 forms foci that colocalize with other DNA damage response factors, after induction of double-strand breaks. Rif1 localizes to double strand breaks in an ATM (ataxia telangiectasia mutated)- and 53BP1-dependent manner and functions in the intra-S-phase checkpoint that serves to slow down DNA synthesis when DNA damage has occurred.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Rif1 Antibody (NBP2-47303)(1)

Publication using NBP2-47303

• Jayavaradhan R, Pillis D. M, et al. CRISPR-Cas9 fusion to dominant-negative 53BP1 enhances HDR and inhibits NHEJ specifically at Cas9 target sites. Nat Commun 2019-06-28 [PMID: 31253785]

Bioinformatics

• Gene Symbol: RIF1