INSL3 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: INSL3 Antibody [NBP1-81223] - Staining in human testis and endometrium tissues using anti-INSL3 antibody. Corresponding INSL3 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: INSL3 Antibody [NBP1-81223] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: INSL3 Antibody [NBP1-81223] - Staining of human endometrium shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

INSL3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
INSL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence - Reported in scientific literature (PMID: 30174296)
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
INSL3 Protein (NBP1-81223PEP)
Publications
Read Publications using
NBP1-81223 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for INSL3 Antibody

  • INSL3
  • insulin-like 3 (Leydig cell)
  • insulin-like 3
  • Ley I-L
  • leydig insulin -like hormone
  • leydig insulin -like peptide
  • Leydig insulin-like peptide
  • Ley-I-L
  • MGC119818
  • MGC119819
  • relaxin-like factor b
  • Relaxin-like factor
  • RLF
  • RLFley-I-L
  • RLNL

Background

Insulin-like 3 (INSL3), a member of the insulin-like hormone superfamily, is specifically expressed in Leydig cells of the fetal and postnatal testis and in theca cells of the postnatal ovary. It is synthesized as a 131-amino acid preproprotein, which contains a 24-amino acid signal peptide. The human INSL3 gene is assigned to bands p13.2-p12 of the short arm of chromosome 19 with the similar organization to that of insulin and relaxin. INSL3 induces gubernaculum development in an androgen-independent way, while androgen-mediated regression of the CSL occurs independently from Insl3. Moreover, INSL3 is a ligand for LGR8 and INSL3-LGR8 mutations are believed to be associated with human cryptorchidism.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for INSL3 Antibody (NBP1-81223)(6)

We have publications tested in 2 confirmed species: Human, Cynomolgus Monkey.

We have publications tested in 3 applications: ICC/IF, IF/IHC, IHC-P.


Filter By Application
ICC/IF
(2)
IF/IHC
(1)
IHC-P
(1)
All Applications
Filter By Species
Human
(3)
Cynomolgus Monkey
(1)
All Species
Showing Publications 1 - 6 of 6.
Publications using NBP1-81223 Applications Species
Wang M, Liu X, Chang G et al. Single-Cell RNA Sequencing Analysis Reveals Sequential Cell Fate Transition during Human Spermatogenesis. Cell Stem Cell 2018-08-24 [PMID: 30174296] (ICC/IF, Human) ICC/IF Human
Lardone MC, Argandona F, Florez M et al. Overexpression of CYP19A1 aromatase in Leydig cells is associated with steroidogenic dysfunction in subjects with Sertoli cell-only syndrome. Andrology 2017-01-01 [PMID: 27769104]
Marie Berg Nygaard, Kristian Almstrup, Louise Lindbaek et al. Cell context-specific expression of primary cilia in the human testis and ciliary coordination of Hedgehog signalling in mouse Leydig cells. Scientific Reports 2015-01-01 [PMID: 25992706] (ICC/IF, Human) ICC/IF Human
Djureinovic D, Fagerberg L, Hallstrom B et al. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Mol Hum Reprod 2014-06-01 [PMID: 24598113]
Huang D, Zuo Y, Zhang C et al. A single-nucleus transcriptomic atlas of primate testicular aging reveals exhaustion of the spermatogonial stem cell reservoir and loss of Sertoli cell homeostasis Protein & Cell 2022-11-18 (IHC-P, Cynomolgus Monkey)

Details:
testicular tissues dilution used 1:500
IHC-P Cynomolgus Monkey
Song K, Yang X, An G et al. Targeting APLN/APJ restores blood-testis barrier and improves spermatogenesis in murine and human diabetic models Nature communications 2022-11-28 [PMID: 36443325] (IF/IHC, Human) IF/IHC Human

Reviews for INSL3 Antibody (NBP1-81223) (0)

There are no reviews for INSL3 Antibody (NBP1-81223). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for INSL3 Antibody (NBP1-81223) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional INSL3 Products

Research Areas for INSL3 Antibody (NBP1-81223)

Find related products by research area.

Blogs on INSL3

There are no specific blogs for INSL3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INSL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol INSL3
Entrez
Uniprot