RhoGDI Antibody (0D6X5)

Western Blot: RhoGDI Antibody (0D6X5) [NBP3-15401] - Western blot analysis of extracts of various cell lines, using RhoGDI Rabbit mAb (NBP3-15401) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Western Blot: RhoGDI Antibody (0D6X5) [NBP3-15401] - Western blot analysis of extracts from normal (control) and RhoGDI knockout (KO) 293T cells, using RhoGDI antibody (NBP3-15401) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, KO
• Clone: 0D6X5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

RhoGDI Antibody (0D6X5) Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit RhoGDI Antibody (0D6X5) (NBP3-15401) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-150 of human RhoGDI (P52565). VVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYG
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ARHGDIA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Knockout Validated
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RhoGDI Antibody (0D6X5)

• GDIA1
• MGC117248
• Rho GDI 1
• Rho GDP dissociation inhibitor (GDI) alpha
• rho GDP-dissociation inhibitor 1
• Rho-GDI alpha
• RHOGDI
• RHOGDI-1

Background

Aplysia Ras-related homologs (ARHs), also called Rho genes, belong to the RAS gene superfamily encoding small guanine nucleotide exchange (GTP/GDP) factors. The ARH proteins may be kept in the inactive, GDP-bound state by interaction with GDP dissociation inhibitors, such as ARHGDIA (Leffers et al., 1993 [PubMed 8262133]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARHGDIA