PAK1 Antibody

Images

 
Western Blot: PAK1 Antibody [NBP1-85802] - Analysis in human cell lines U2OS and MCF-7 using Anti-PAK1 antibody. Corresponding PAK1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: PAK1 Antibody [NBP1-85802] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: PAK1 Antibody [NBP1-85802] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Western Blot: PAK1 Antibody [NBP1-85802] - Analysis in human cell line U-2197.
Western Blot: PAK1 Antibody [NBP1-85802] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
       

Orthogonal Strategies

 

Order Details

PAK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PAK1 Protein (NBP1-85802PEP)
Publications
Read Publication using NBP1-85802.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23436904)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PAK1 Antibody

  • alpha-PAK
  • EC 2.7.11
  • EC 2.7.11.1
  • MGC130000
  • MGC130001
  • p21 protein (Cdc42/Rac)-activated kinase 1
  • p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast)
  • p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related)
  • p21-activated kinase 1
  • p65-PAK
  • PAK1
  • PAK-1
  • PAKalpha
  • serine/threonine-protein kinase PAK 1
  • STE20 homolog, yeast

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47542
Species: Hu, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-37573
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-85802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PAK1 Antibody (NBP1-85802)(1)

Reviews for PAK1 Antibody (NBP1-85802) (0)

There are no reviews for PAK1 Antibody (NBP1-85802). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PAK1 Antibody (NBP1-85802) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PAK1 Products

Bioinformatics Tool for PAK1 Antibody (NBP1-85802)

Discover related pathways, diseases and genes to PAK1 Antibody (NBP1-85802). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAK1 Antibody (NBP1-85802)

Discover more about diseases related to PAK1 Antibody (NBP1-85802).
 

Pathways for PAK1 Antibody (NBP1-85802)

View related products by pathway.

PTMs for PAK1 Antibody (NBP1-85802)

Learn more about PTMs related to PAK1 Antibody (NBP1-85802).
 

Research Areas for PAK1 Antibody (NBP1-85802)

Find related products by research area.

Blogs on PAK1.

Myosin is More than Just a Heavy Lifter
Myosin is a well-known, hexameric molecular motor that is a key cytoskeletal component. It consists of a pair of myosin heavy chain subunits (MHC), a pair of essential myosin light chain subunits (MLC), and a pair of regulatory light chain subunits (R...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAK1
Entrez