PAK1 Antibody - BSA Free

Staining of human rectum shows strong cytoplasmic ad membranous positivity in glandular cells.

Staining of human pancreas shows no positivity in endocrine glandular cells as expected.

Staining of human lymph node shows moderate cytoplasmic positivity in non-germinal center cells.

Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using HPA003565 antibody. Corresponding PAK1 RNA-seq data are presented for the same tissues.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in human cell lines U2OS and MCF-7 using Anti-PAK1 antibody. Corresponding PAK1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PAK1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PAK1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PAK1 Protein (NBP1-85802PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23436904)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PAK1 Antibody - BSA Free

• alpha-PAK
• EC 2.7.11
• EC 2.7.11.1
• MGC130000
• MGC130001
• p21 protein (Cdc42/Rac)-activated kinase 1
• p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast)
• p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related)
• p21-activated kinase 1
• p65-PAK
• PAK1
• PAK-1
• PAKalpha
• serine/threonine-protein kinase PAK 1
• STE20 homolog, yeast

Background

p21-activated kinase 1 (PAK1) is a member of a family of serine/threonine protein kinase defined by their interaction with the small GTPases, Cdc42 and Rac (1-2). The PAK proteins can be essentially divided into two categories, groups I (PAK1, PAK2 and PAK3) and group II (PAK4, PAK5 and PAK6), based on their structures (3). PAK1 participates in regulating the actin cytoskeleton, focal adhesion contacts, cell motility, apoptosis and transcription. It also promotes the disassembly of stress fibers (4-5). PAK1 also binds PIX (PAK-binding protein), COOL and adapter protein Nck (5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PAK1 Antibody (NBP1-85802)(1)

Publication using NBP1-85802

• Geiger T, Velic A, Macek B et al. Initial Quantitative Proteomic Map of 28 Mouse Tissues Using the SILAC Mouse. Mol Cell Proteomics 2013-06-01 [PMID: 23436904]

Bioinformatics

• Gene Symbol: PAK1