Recombinant Human RhoF Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RhoF Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-170 of Human RHOF full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDAPGALAQTAAPGPGRKELKIVIVGDGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYMQVGRGQDPGAQPWL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
RHOF
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RhoF Protein

  • FLJ20247
  • ras homolog gene family, member F (in filopodia)
  • Rho family GTPase Rif
  • Rho in filopodia
  • rho-related GTP-binding protein RhoF
  • RIFARHF

Background

RHOF( AAH18208, 1 a.a. - 171 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
H00004498-R01
Species: Hu
NB100-1813
Species: Hu
Applications: WB, IP
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-24689
Species: Hu, Mu
Applications: WB
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB110-89459
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP2-46466
Species: Hu
Applications: IHC
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RhoF Recombinant Protein (H00054509-P01) (0)

There are no publications for RhoF Recombinant Protein (H00054509-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RhoF Recombinant Protein (H00054509-P01) (0)

There are no reviews for RhoF Recombinant Protein (H00054509-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RhoF Recombinant Protein (H00054509-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RhoF Products

Bioinformatics Tool for RhoF Recombinant Protein (H00054509-P01)

Discover related pathways, diseases and genes to RhoF Recombinant Protein (H00054509-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RhoF Recombinant Protein (H00054509-P01)

Discover more about diseases related to RhoF Recombinant Protein (H00054509-P01).
 

Pathways for RhoF Recombinant Protein (H00054509-P01)

View related products by pathway.

PTMs for RhoF Recombinant Protein (H00054509-P01)

Learn more about PTMs related to RhoF Recombinant Protein (H00054509-P01).
 

Research Areas for RhoF Recombinant Protein (H00054509-P01)

Find related products by research area.

Blogs on RhoF

There are no specific blogs for RhoF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF
Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RhoF Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RHOF