HAI-2/SPINT2 Antibody - BSA Free

Immunohistochemistry-Paraffin: HAI-2/SPINT2 Antibody [NBP1-83299] -Staining of human placenta shows strong membranous and cytoplasmic positivity in trophoblastic cells.

Staining of human placenta shows strong membranous and cytoplasmic positivity in trophoblastic cells.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human rectum shows strong membranous and cytoplasmic positivity in glandular cells.

Staining of human prostate shows strong membranous and cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HAI-2/SPINT2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HAI-2/SPINT2 Antibody - BSA Free (NBP1-83299) is a polyclonal antibody validated for use in IHC and WB. Anti-HAI-2/SPINT2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPINT2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot Reported in scientific literature (PMID: 24962579)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HAI-2/SPINT2 Protein (NBP1-83299PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24962579).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HAI-2/SPINT2 Antibody - BSA Free

• HAI2
• HAI-2
• HAI-2DIAR3
• HAI2FLJ45571
• Hepatocyte growth factor activator inhibitor type 2
• Kop
• kunitz-type protease inhibitor 2
• PB
• Placental bikunin
• serine peptidase inhibitor, Kunitz type, 2
• serine protease inhibitor, Kunitz type, 2

Background

The SPINT2 gene encodes a transmembrane protein with two extracellular Kunitz domains that inhibits a variety of serine proteases. The protein inhibits HGF activator which prevents the formation of active hepatocyte growth factor. This gene is a putative tumor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HAI-2/SPINT2 Antibody (NBP1-83299)(2)

Publications using NBP1-83299

• Zajaczkowska R, Popiolek-Barczyk K, Pilat D et al. Involvement of microglial cells in the antinociceptive effects of metamizol in a mouse model of neuropathic pain. Pharmacol. Biochem. Behav. 2018-09-26 [PMID: 30267794] (WB, Mouse)
• Friis S, Sales KU, Schafer JM et al. The Protease Inhibitor HAI-2, but Not HAI-1, Regulates Matriptase Activation and Shedding through Prostasin. J Biol Chem 2014-08-08 [PMID: 24962579] (WB, Mouse)

Bioinformatics

• Gene Symbol: SPINT2