HAI-2/SPINT2 Antibody

Images

 
Western Blot: HAI-2/SPINT2 Antibody [NBP1-83299] - Analysis in control (vector only transfected HEK293T lysate) and sPINT2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: HAI-2/SPINT2 Antibody [NBP1-83299] - Staining of human placenta shows distinct membranous and moderate cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HAI-2/SPINT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPINT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HAI-2/SPINT2 Protein (NBP1-83299PEP)
Publications
Read Publication using
NBP1-83299 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24962579).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HAI-2/SPINT2 Antibody

  • HAI2
  • HAI-2
  • HAI-2DIAR3
  • HAI2FLJ45571
  • Hepatocyte growth factor activator inhibitor type 2
  • Kop
  • kunitz-type protease inhibitor 2
  • PB
  • Placental bikunin
  • serine peptidase inhibitor, Kunitz type, 2
  • serine protease inhibitor, Kunitz type, 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF2009
Species: Hu
Applications: WB, IHC
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00347527-B01P
Species: Hu
Applications: WB, ELISA
MAB38461
Species: Hu
Applications: WB, IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for HAI-2/SPINT2 Antibody (NBP1-83299)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for HAI-2/SPINT2 Antibody (NBP1-83299) (0)

There are no reviews for HAI-2/SPINT2 Antibody (NBP1-83299). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HAI-2/SPINT2 Antibody (NBP1-83299) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HAI-2/SPINT2 Products

Bioinformatics Tool for HAI-2/SPINT2 Antibody (NBP1-83299)

Discover related pathways, diseases and genes to HAI-2/SPINT2 Antibody (NBP1-83299). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HAI-2/SPINT2 Antibody (NBP1-83299)

Discover more about diseases related to HAI-2/SPINT2 Antibody (NBP1-83299).
 

Pathways for HAI-2/SPINT2 Antibody (NBP1-83299)

View related products by pathway.

PTMs for HAI-2/SPINT2 Antibody (NBP1-83299)

Learn more about PTMs related to HAI-2/SPINT2 Antibody (NBP1-83299).
 

Research Areas for HAI-2/SPINT2 Antibody (NBP1-83299)

Find related products by research area.

Blogs on HAI-2/SPINT2

There are no specific blogs for HAI-2/SPINT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HAI-2/SPINT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPINT2
Entrez