RFXANK Antibody (4G10) - Azide and BSA Free

Western Blot: RFXANK Antibody (4G10) [H00008625-M01] - Analysis of RFXANK expression in transfected 293T cell line by RFXANK monoclonal antibody (M01), clone 4G10.Lane 1: RFXANK transfected lysate (Predicted MW: 25.6 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: RFXANK Antibody (4G10) [H00008625-M01] - Analysis of monoclonal antibody to RFXANK on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: RFXANK Antibody (4G10) [H00008625-M01] - Detection limit for recombinant GST tagged RFXANK is approximately 3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 4G10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RFXANK Antibody (4G10) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: RFXANK (NP_003712.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPVNPEPDASVSSPQAGSSLKHSTTLTNRQRGNEVSALPATLD
• Specificity: RFXANK - regulatory factor X-associated ankyrin-containing protein (4G10)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RFXANK
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RFXANK Antibody (4G10) - Azide and BSA Free

• ANKRA1Regulatory factor X subunit B
• ankyrin repeat-containing regulatory factor X-associated protein
• BLS
• DNA-binding protein RFXANK
• F14150_1
• MGC138628
• regulatory factor X-associated ankyrin-containing proteinAnkyrin repeat family A protein 1
• RFXB
• RFX-BRFX-Bdelta4

Background

Major histocompatibility (MHC) class II molecules are transmembrane proteins that have a central role in development and control of the immune system. The protein encoded by this gene, along with regulatory factor X-associated protein and regulatory factor-5, forms a complex that binds to the X box motif of certain MHC class II gene promoters and activates their transcription. Once bound to the promoter, this complex associates with the non-DNA-binding factor MHC class II transactivator, which controls the cell type specificity and inducibility of MHC class II gene expression. This protein contains ankyrin repeats involved in protein-protein interactions. Mutations in this gene have been linked to bare lymphocyte syndrome type II, complementation group B. Two transcript variants encoding different isoforms have been described for this gene, with only one isoform showing activation activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RFXANK
• Entrez:
  • 8625(Human)
• Uniprot:
  • NP_003712(Human)