RFX6 Antibody - BSA Free

Western Blot: RFX6 Antibody [NBP2-48677] - Analysis in control (vector only transfected HEK293T lysate) and RFX6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: RFX6 Antibody [NBP2-48677] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.

Immunohistochemistry-Paraffin: RFX6 Antibody [NBP2-48677] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.

Immunohistochemistry-Paraffin: RFX6 Antibody [NBP2-48677] - Staining of human fallopian tube shows weak positivity in cilia in glandular cells.

Immunohistochemistry-Paraffin: RFX6 Antibody [NBP2-48677] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

ChIP-Exo-Seq composite graph for Anti-RFX6 (NBP2-48677) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: WB, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RFX6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RFX6 Antibody - BSA Free (NBP2-48677) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SHCSTYPEPIYPTLPQANHDFYSTSSNYQTVFRAQPHSTSGLYPHHTEHGRCMAWTEQQLSRDFFSGSCAGSPYNSRPPSSYGPSLQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RFX6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RFX6 Recombinant Protein Antigen (NBP2-48677PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RFX6 Antibody - BSA Free

• dJ955L16.1
• DNA-binding protein RFX6
• MGC33442
• MTFS
• Regulatory factor X 6
• Regulatory factor X domain-containing protein 1
• regulatory factor X, 6
• RFX6
• RFXDC1
• RFXDC1regulatory factor X domain containing 1

Background

RFX6 is a member of the regulatory factor X (RFX) family of transcription factors (see RFX1; MIM 600006) (Aftab et al., 2008 [PubMed 18673564]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RFX6