FoxP4 Antibody

Images

 
Western Blot: FoxP4 Antibody [NBP1-83449] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: FoxP4 Antibody [NBP1-83449] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FoxP4 Antibody [NBP1-83449] - Staining of human stomach shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FoxP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SPTLVKNMISGLSYGALNASYQAALAESSFPLLNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEELPGE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOXP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FoxP4 Protein (NBP1-83449PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FoxP4 Antibody

  • FKHLA
  • FLJ40908
  • FLJ44184
  • fork head-related protein like A
  • Fork head-related protein-like A
  • forkhead box P4
  • forkhead box protein P4
  • FoxP4
  • hFKHLA
  • winged-helix repressor FOXP4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65125
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-55411
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-56179
Species: Hu
Applications: ICC/IF
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-57999
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP
NBP2-22261
Species: Hu, Mu, Ch
Applications: WB, IP
NBP1-85965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-38866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00139628-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-60018
Species: Hu
Applications: WB
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-83449
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FoxP4 Antibody (NBP1-83449) (0)

There are no publications for FoxP4 Antibody (NBP1-83449).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxP4 Antibody (NBP1-83449) (0)

There are no reviews for FoxP4 Antibody (NBP1-83449). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FoxP4 Antibody (NBP1-83449) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FoxP4 Products

Bioinformatics Tool for FoxP4 Antibody (NBP1-83449)

Discover related pathways, diseases and genes to FoxP4 Antibody (NBP1-83449). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxP4 Antibody (NBP1-83449)

Discover more about diseases related to FoxP4 Antibody (NBP1-83449).
 

Pathways for FoxP4 Antibody (NBP1-83449)

View related products by pathway.

PTMs for FoxP4 Antibody (NBP1-83449)

Learn more about PTMs related to FoxP4 Antibody (NBP1-83449).

Blogs on FoxP4

There are no specific blogs for FoxP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FoxP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXP4
Entrez