RENBP Antibody - BSA Free

Western Blot: RENBP Antibody [NBP2-88138] - WB Suggested Anti-RENBP Antibody. Titration: 1.0 ug/ml. Positive Control: 721_B Whole CellRENBP is supported by BioGPS gene expression data to be expressed in 721_B

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RENBP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RENBP Antibody - BSA Free (NBP2-88138) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of RENBP. Peptide sequence: PHSEAMIAFLMGYSDSGDPVLLRLFYQVAEYTFRQFRDPEYGEWFGYLSR The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RENBP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RENBP Antibody - BSA Free

• AGE
• EC 5.1.3.8
• GlcNAc 2-epimerase
• N-acetyl-D-glucosamine 2-epimerase
• N-acylglucosamine 2-epimerase
• RBP
• renin binding protein
• Renin-binding protein
• RNBP

Background

RENBP, also known as N-acylglucosamine 2-epimerase, is a 49kDa 427 amino acid protein with a shorter 29kDa 254 isoform produced by alternative splicing. RENBP functions as a catalyzer in the conversion of N-acetylglucosamine to N-acetylmannosamine. Current research is being conducted on RENBP in relation to sialuria, Wilms tumor, allergic rhinitis, myopathy, vascular disease, hypertension, nephropathy, proteinuria and aldosteronism. RENBP has been linked to the amino sugar and nucleotide sugar metabolism pathways where it interacts with HEXA, HEXB, GNE, REN and ZBED1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RENBP