| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: WKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQ |
| Predicted Species | Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RELB |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-34064 | Applications | Species |
|---|---|---|
| Burda JE, O'Shea TM, Ao Y et al. Divergent transcriptional regulation of astrocyte reactivity across disorders Nature 2022-05-25 [PMID: 35614216] (IHC-Fr, Mouse) | IHC-Fr | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for RelB Antibody (NBP2-34064)Find related products by research area.
|
|
NFkB and p62 Both Activate and Regulate Inflammation Nuclear factor kappa-light-chain-enhancer of activated B cells (NFkB) is a protein complex that regulates DNA transcription and is a critical regulator of cell survival. NFkB has long been known as a primer of inflammation, however researchers are ... Read full blog post. |
|
RelA/NF-kB - A proinflammatory signaling pathway with roles in immunity and cancer The inflammatory response consists of a complex network of signaling pathways that regulate a diverse set of cytokines, growth factors, adhesion molecules, and transcription factors (1). Of the proinflammatory signaling pathways the NF-kB family is... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.