Reg3A Antibody - BSA Free

Immunohistochemistry: Reg3A Antibody [NBP2-48903] - Staining of human small intestine shows strong cytoplasmic positivity in subset of glandular cells.

Analysis in human small intestine and skeletal muscle tissues using NBP2-48903 antibody. Corresponding REG3A RNA-seq data are presented for the same tissues.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human kidney shows no positivity in cells in tubules as expected.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Reg3A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Reg3A Antibody - BSA Free (NBP2-48903) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KAYGSHCYALFLSPKSWTDADLACQKRPSGNL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: REG3A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Reg3A Recombinant Protein Antigen (NBP2-48903PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Reg3A Antibody - BSA Free

• hepatocarcinoma-intestine-pancreas
• HIPpancreatitis-associated protein
• Human proislet peptide
• Lithostathine 3
• pancreatic beta cell growth factor
• Pancreatitis-associated protein 1
• PAP homologous protein
• PAP1FLJ18565
• PAP2
• PAPPAP-H
• PBCGF
• proliferation-inducing protein 34
• proliferation-inducing protein 42
• Reg III-alpha
• REG3
• Reg3A
• REG-3-alpha
• regenerating islet-derived 3 alpha
• regenerating islet-derived protein 3-alpha
• Regenerating islet-derived protein III-alpha
• REG-III

Background

The Reg3a gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver c

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: REG3A