RCOR2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RCOR2 Antibody [NBP1-92323] - Staining of human cell line Hep G2 shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RCOR2 Antibody [NBP1-92323] - Staining of mouse embryo E14 shows strong nuclear positivity in developing neurons.
Immunohistochemistry-Paraffin: RCOR2 Antibody [NBP1-92323] - Staining of human astrocytoma shows moderate nuclear positivity in a subset of tumor cells.
Immunohistochemistry-Paraffin: RCOR2 Antibody [NBP1-92323] - Staining of human prostate shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: RCOR2 Antibody [NBP1-92323] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RCOR2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PSVMEKPSAGSGILSRSRAKTVPNGGQPHSEDDSSEEEHSHDSMIRVGTNYQAVIPECKPESPARYSNKELKGMLVWSPNHCVSDAK
Predicted Species
Mouse (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RCOR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot -Reactivity reported in (PMID: 24820421)
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RCOR2 Recombinant Protein Antigen (NBP1-92323PEP)
Publications
Read Publications using
NBP1-92323 in the following applications:

Reactivity Notes

Use in Rat reported in scientific literature (PMID:26111147).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RCOR2 Antibody

  • CoREST2
  • REST corepressor 2

Background

RCOR2 may act as a component of a corepressor complex that represses transcription (Potential)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RCOR2 Antibody (NBP1-92323)(3)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 3 applications: ICC/IF, IF/IHC, WB.


Filter By Application
ICC/IF
(1)
IF/IHC
(1)
WB
(2)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
Rat
(2)
All Species

Reviews for RCOR2 Antibody (NBP1-92323) (0)

There are no reviews for RCOR2 Antibody (NBP1-92323). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RCOR2 Antibody (NBP1-92323) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RCOR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RCOR2