RCOR2 Antibody

Images

 
Western Blot: RCOR2 Antibody [NBP1-92323] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: RCOR2 Antibody [NBP1-92323] - Staining of human cell line Hep G2 shows localization to nucleus.
Immunohistochemistry-Paraffin: RCOR2 Antibody [NBP1-92323] - Staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: RCOR2 Antibody [NBP1-92323] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RCOR2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PSVMEKPSAGSGILSRSRAKTVPNGGQPHSEDDSSEEEHSHDSMIRVGTNYQAVIPECKPESPARYSNKELKGMLVWSPNHCVSDAK
Specificity
Specificity of human RCOR2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RCOR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RCOR2 Recombinant Protein Antigen (NBP1-92323PEP)
Publications
Read Publications using
NBP1-92323 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Rat, Human reactivity reported in scientific literature (PMID: 24820421).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RCOR2 Antibody

  • CoREST2
  • REST corepressor 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6047
Species: Hu
Applications: WB, ICC
NB100-757
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1762
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ChIP, ELISA, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46429
Species: Hu
Applications: WB, IHC, IF
H00010362-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00006326-Q01
Species: Hu
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-56179
Species: Hu
Applications: ICC/IF
NBP1-87227
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
AF2156
Species: Hu, Mu
Applications: WB, IHC
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-39015
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-27173
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, IHC-P
H00008328-P01
Species: Hu

Publications for RCOR2 Antibody (NBP1-92323)(2)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Rat
(2)
All Species

Reviews for RCOR2 Antibody (NBP1-92323) (0)

There are no reviews for RCOR2 Antibody (NBP1-92323). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RCOR2 Antibody (NBP1-92323) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RCOR2 Antibody (NBP1-92323)

Discover related pathways, diseases and genes to RCOR2 Antibody (NBP1-92323). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RCOR2 Antibody (NBP1-92323)

Discover more about diseases related to RCOR2 Antibody (NBP1-92323).
 

Pathways for RCOR2 Antibody (NBP1-92323)

View related products by pathway.

PTMs for RCOR2 Antibody (NBP1-92323)

Learn more about PTMs related to RCOR2 Antibody (NBP1-92323).

Blogs on RCOR2

There are no specific blogs for RCOR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RCOR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RCOR2