RCOR2 Antibody

Immunocytochemistry/Immunofluorescence: RCOR2 Antibody [NBP1-92323] - Staining of human cell line Hep G2 shows localization to nucleus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RCOR2 Antibody [NBP1-92323] - Staining of mouse embryo E14 shows strong nuclear positivity in developing neurons.

Immunohistochemistry-Paraffin: RCOR2 Antibody [NBP1-92323] - Staining of human astrocytoma shows moderate nuclear positivity in a subset of tumor cells.

Immunohistochemistry-Paraffin: RCOR2 Antibody [NBP1-92323] - Staining of human prostate shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: RCOR2 Antibody [NBP1-92323] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

• Reactivity: Hu, Rt, Mu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

RCOR2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PSVMEKPSAGSGILSRSRAKTVPNGGQPHSEDDSSEEEHSHDSMIRVGTNYQAVIPECKPESPARYSNKELKGMLVWSPNHCVSDAK
• Predicted Species: Mouse (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RCOR2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. WB reactivity reported in (PMID: 24820421).
• Control Peptide:

  RCOR2 Recombinant Protein Antigen (NBP1-92323PEP)

Reactivity Notes

Rat, Human reactivity reported in scientific literature (PMID: 24820421). Use in Rat reported in scientific literature (PMID:26111147).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RCOR2 Antibody

• CoREST2
• REST corepressor 2

Background

RCOR2 may act as a component of a corepressor complex that represses transcription (Potential)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RCOR2 Antibody (NBP1-92323)(3)

Publications using NBP1-92323

• Pei L, Zhang H, Zhang M et al. Rcor2 Is Required for Somatic Differentiation and Represses Germline Cell Fate Stem cells international 2022-03-19 [PMID: 35345626] (WB, Mouse)
• Saez JE, Gomez AV, Barrios AP et al. Decreased Expression of CoREST1 and CoREST2 Together with LSD1 and HDAC1/2 during Neuronal Differentiation. PLoS One 2015-01-01 [PMID: 26111147] (ICC/IF, Rat)
• Barrios OP, Gomez AV, Saez JE et al. Differential Properties of Transcriptional Complexes Formed by the CoREST Family. Mol Cell Biol 2014-07-01 [PMID: 24820421] (IHC, WB, Human, Rat)

Bioinformatics

• Gene Symbol: RCOR2