PCP2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PCP2 Antibody [NBP2-56179] - Staining of human cell line NB-4 shows localization to nuclear speckles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCP2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPTPEMDSLMDMLASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPL
Specificity
Specificity of human PCP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCP2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse 82%, Rat 85%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PCP2 Antibody

  • DKFZp686M0187
  • FLJ27345
  • GPSM4
  • L7
  • MGC41903
  • Purkinje cell protein 2 homolog
  • Purkinje cell protein 2
  • Purkinje cell-specific protein L7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2269
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
MAB7475
Species: Hu, Rt
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-50028
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-FrFl
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91968
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00117144-Q01
Species: Hu
NBP2-24516
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-53125
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB300-189
Species: Mu, Rt
Applications: WB, ICC/IF, IHC-Fr
NBP1-83449
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
AF6278
Species: Hu, Mu
Applications: WB
NBP2-56179
Species: Hu
Applications: ICC/IF

Publications for PCP2 Antibody (NBP2-56179) (0)

There are no publications for PCP2 Antibody (NBP2-56179).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCP2 Antibody (NBP2-56179) (0)

There are no reviews for PCP2 Antibody (NBP2-56179). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PCP2 Antibody (NBP2-56179) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PCP2 Products

Bioinformatics Tool for PCP2 Antibody (NBP2-56179)

Discover related pathways, diseases and genes to PCP2 Antibody (NBP2-56179). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCP2 Antibody (NBP2-56179)

Discover more about diseases related to PCP2 Antibody (NBP2-56179).
 

Pathways for PCP2 Antibody (NBP2-56179)

View related products by pathway.

PTMs for PCP2 Antibody (NBP2-56179)

Learn more about PTMs related to PCP2 Antibody (NBP2-56179).

Blogs on PCP2.

RNA-binding protein Staufen1 conspires with Atxn2 in stress granules to cause neurodegeneration by dysregulating RNA metabolism
By Jamshed Arslan Pharm.D. Spinocerebellar ataxia type 2 (SCA2) is a movement disorder characterized by neurodegeneration. The cause of this autosomal dominant disease is a mutation in the RNA processing gene Atxn2,...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCP2