GFI1B Antibody

Images

 
Western Blot: GFI1B Antibody [NBP2-84040] - WB Suggested Anti-GFI1B Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysate
Immunohistochemistry-Paraffin: GFI1B Antibody [NBP2-84040] - Rabbit Anti-GFI1B Antibody. Paraffin Embedded Tissue: Human Kidney. Cellular Data: Epithelial cells of renal tubule and renal corpuscle. Antibody ...read more
Western Blot: GFI1B Antibody [NBP2-84040] - Host: Rabbit. Target: GFI1B. Positive control (+): Mouse testis (M-TE). Negative control (-): Rat liver (R-LI). Antibody concentration: 1ug/ml
Immunohistochemistry-Paraffin: GFI1B Antibody [NBP2-84040] - Rabbit Anti-GFI1B Antibody. Paraffin Embedded Tissue: Human Heart. Cellular Data: Myocardial cells. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GFI1B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GFI1B. Peptide sequence: MPRSFLVKSKMAHTYHQPRVQEDEPLWPPALTPVPRDQAPSNSPVLSTLF The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
GFI1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GFI1B Antibody

  • growth factor independent 1B transcription repressor
  • Growth factor independent protein 1B
  • Potential regulator of CDKN1A translocated in CML
  • translocated inCML)
  • zinc finger protein Gfi-1b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3540
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-01488
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-1762
Species: Hu, Mu, Pm
Applications: ChIP, ELISA, IHC, IHC-P, Simple Western, WB
NBP2-47572
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-48693
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-47940
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF4984
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3194
Species: Hu
Applications: ICC, Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
202-IL
Species: Hu
Applications: BA
NBP2-57636
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-16225
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NB100-56637
Species: Hu, Mu
Applications: WB
NB110-61646
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-03886
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-84040
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GFI1B Antibody (NBP2-84040) (0)

There are no publications for GFI1B Antibody (NBP2-84040).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GFI1B Antibody (NBP2-84040) (0)

There are no reviews for GFI1B Antibody (NBP2-84040). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GFI1B Antibody (NBP2-84040) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GFI1B Products

Bioinformatics Tool for GFI1B Antibody (NBP2-84040)

Discover related pathways, diseases and genes to GFI1B Antibody (NBP2-84040). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GFI1B Antibody (NBP2-84040)

Discover more about diseases related to GFI1B Antibody (NBP2-84040).
 

Pathways for GFI1B Antibody (NBP2-84040)

View related products by pathway.

PTMs for GFI1B Antibody (NBP2-84040)

Learn more about PTMs related to GFI1B Antibody (NBP2-84040).
 

Research Areas for GFI1B Antibody (NBP2-84040)

Find related products by research area.

Blogs on GFI1B

There are no specific blogs for GFI1B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GFI1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GFI1B