RCC2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: ESTISWGPSPTFGELGYGDHKPKSSTAAQEVKTLDGIFSEQVAMGYSHSLVIARDESETEKEKIKKLPEYN |
| Predicted Species |
Mouse (93%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RCC2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for RCC2 Antibody - BSA Free
Background
RCC2 (regulator of chromosome condensation 2) is a member of the RCC1 family of guanine nucleotide exchange factors. RCC2 has been identified as part of the chromosomal passenger complex (CPC) which coordinates the chromosomal and cytoskeletal events of mitosis. Chromosomal passengers are proteins present in complexes with aurora B, inner centromeric protein (INCENP), survivin, and borealin. RCC2 has been demonstrated to be required for the recruitment of survivin and aurora B and is essential for proper chromosome segregation and the completion of cell cleavage. Loss of RCC2 inhibits spindle assembly, activates the spindle assembly checkpoint, and blocks cells in prometaphase.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
Species: Hu, Ma, Mu, Po, Rt
Applications: ICC/IF, IP, KO, Simple Western, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Publications for RCC2 Antibody (NBP2-49676) (0)
There are no publications for RCC2 Antibody (NBP2-49676).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RCC2 Antibody (NBP2-49676) (0)
There are no reviews for RCC2 Antibody (NBP2-49676).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for RCC2 Antibody (NBP2-49676) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RCC2 Products
Blogs on RCC2