RCC2 Antibody - BSA Free

Immunohistochemistry: RCC2 Antibody [NBP2-49676] - Staining of human esophagus shows moderate nuclear positivity in squamous epithelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RCC2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RCC2 Antibody - BSA Free (NBP2-49676) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ESTISWGPSPTFGELGYGDHKPKSSTAAQEVKTLDGIFSEQVAMGYSHSLVIARDESETEKEKIKKLPEYN
• Predicted Species: Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RCC2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RCC2 Recombinant Protein Antigen (NBP2-49676PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RCC2 Antibody - BSA Free

• DKFZp762N0610
• KIAA1470
• protein RCC2
• RCC1-like protein TD-60
• regulator of chromosome condensation 2
• TD60
• TD-60
• Telophase disk protein of 60 kDa

Background

RCC2 (regulator of chromosome condensation 2) is a member of the RCC1 family of guanine nucleotide exchange factors. RCC2 has been identified as part of the chromosomal passenger complex (CPC) which coordinates the chromosomal and cytoskeletal events of mitosis. Chromosomal passengers are proteins present in complexes with aurora B, inner centromeric protein (INCENP), survivin, and borealin. RCC2 has been demonstrated to be required for the recruitment of survivin and aurora B and is essential for proper chromosome segregation and the completion of cell cleavage. Loss of RCC2 inhibits spindle assembly, activates the spindle assembly checkpoint, and blocks cells in prometaphase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RCC2