RBP4/Retinol-Binding Protein 4 Antibody - BSA Free

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.

Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RBP4/Retinol-Binding Protein 4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RBP4/Retinol-Binding Protein 4 Antibody - BSA Free (NBP1-86173) is a polyclonal antibody validated for use in IHC. Anti-RBP4/Retinol-Binding Protein 4 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCA
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBP4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RBP4/Retinol-Binding Protein 4 Protein (NBP1-86173PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RBP4/Retinol-Binding Protein 4 Antibody - BSA Free

• interstitial
• Plasma retinol-binding protein
• RBP4
• retinol binding protein 4, plasma
• RetinolBinding Protein 4
• retinol-binding protein 4, plasma

Background

RBP4 is a specific carrier for retinol in the blood. It is a member of the lipocalin protein family. Under physiological conditions, RBP binds transthyretin (TTR) to prevent glomerular filtration of low molecular weight RBP in the kidneys. The RBP/TTR molar ration provides an indirect way to indicate marginal vitamin A deficiency. RBP4 may also play a role in insulin resistance in diabetes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RBP4/Retinol-Binding Protein 4 Antibody (NBP1-86173)(2)

Publications using NBP1-86173

• Bouchal P, Jarkovsky J, Hrazdilova K et al. The new platinum-based anticancer agent LA-12 induces retinol binding protein 4 in vivo. Proteome Sci 2011-10-01 [PMID: 22040120]
• O', Leary Valerie, Kashyap Sangeeta et al. Analysis of the Retinol Binding Protein-4 in Omental Fat of Bariatric Patients. Obesity (Silver Spring) 2009-10-10 [PMID: 19816414]

Bioinformatics

• Gene Symbol: RBP4