RBM34 Antibody

Images

 
Western Blot: RBM34 Antibody [NBP1-83039] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: RBM34 Antibody [NBP1-83039] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: RBM34 Antibody [NBP1-83039] - Staining of human skin shows strong nucleolar positivity in epidermal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBM34 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GQVASSLFRGEHHSRGGTGRLASLFSSLEPQIQPVYVPVPKQTIKKTKRNEEEESTSQIERPLSQEPAKKVKAKKKHTNA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM34
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBM34 Protein (NBP1-83039PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBM34 Antibody

  • KIAA0117RNA-binding motif protein 34
  • RNA binding motif protein 34
  • RNA-binding protein 34

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7158
Species: Hu, Mu
Applications: WB, IHC
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84437
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52911
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80611
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31241
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89426
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85062
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48700
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01017
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
MAB4648
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF

Publications for RBM34 Antibody (NBP1-83039) (0)

There are no publications for RBM34 Antibody (NBP1-83039).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM34 Antibody (NBP1-83039) (0)

There are no reviews for RBM34 Antibody (NBP1-83039). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBM34 Antibody (NBP1-83039) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM34 Products

Bioinformatics Tool for RBM34 Antibody (NBP1-83039)

Discover related pathways, diseases and genes to RBM34 Antibody (NBP1-83039). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM34 Antibody (NBP1-83039)

Discover more about diseases related to RBM34 Antibody (NBP1-83039).
 

Pathways for RBM34 Antibody (NBP1-83039)

View related products by pathway.

Blogs on RBM34

There are no specific blogs for RBM34, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM34 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM34