CALML5 Antibody


Western Blot: CALML5 Antibody [NBP1-84437] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed more
Immunocytochemistry/ Immunofluorescence: CALML5 Antibody [NBP1-84437] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: CALML5 Antibody [NBP1-84437] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: CALML5 Antibody [NBP1-84437] - Staining of human skin shows strong cytoplasmic and nuclear positivity in stratum granulosum of epidermis.
Immunohistochemistry-Paraffin: CALML5 Antibody [NBP1-84437] - Staining in human skin and skeletal muscle tissues using anti-CALML5 antibody. Corresponding CALML5 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

CALML5 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDGDGDGEISFQEFLTA
Specificity of human CALML5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CALML5 Protein (NBP1-84437PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CALML5 Antibody

  • calmodulin-like 5
  • calmodulin-like protein 5
  • CLSPCalmodulin-like skin protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IP
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC-P, IP, PLA
Species: Hu, Mu
Applications: WB, IHC
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CALML5 Antibody (NBP1-84437) (0)

There are no publications for CALML5 Antibody (NBP1-84437).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CALML5 Antibody (NBP1-84437) (0)

There are no reviews for CALML5 Antibody (NBP1-84437). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CALML5 Antibody (NBP1-84437) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CALML5 Products

Bioinformatics Tool for CALML5 Antibody (NBP1-84437)

Discover related pathways, diseases and genes to CALML5 Antibody (NBP1-84437). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CALML5 Antibody (NBP1-84437)

Discover more about diseases related to CALML5 Antibody (NBP1-84437).

Pathways for CALML5 Antibody (NBP1-84437)

View related products by pathway.

Blogs on CALML5

There are no specific blogs for CALML5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CALML5 Antibody and receive a gift card or discount.


Gene Symbol CALML5