CALML5 Antibody

Images

 
Western Blot: CALML5 Antibody [NBP1-84437] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: CALML5 Antibody [NBP1-84437] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: CALML5 Antibody [NBP1-84437] - Staining of human skin shows strong cytoplasmic and nuclear positivity in stratum granulosum of epidermis.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CALML5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDGDGDGEISFQEFLTA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CALML5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CALML5 Protein (NBP1-84437PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CALML5 Antibody

  • calmodulin-like 5
  • calmodulin-like protein 5
  • CLSPCalmodulin-like skin protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4604
Species: Hu
Applications: WB, IHC
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00163688-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00007134-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-14909
Species: Hu
Applications: WB, IP
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP1-37003
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
MAB7158
Species: Hu, Mu
Applications: WB, IHC
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CALML5 Antibody (NBP1-84437) (0)

There are no publications for CALML5 Antibody (NBP1-84437).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CALML5 Antibody (NBP1-84437) (0)

There are no reviews for CALML5 Antibody (NBP1-84437). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CALML5 Antibody (NBP1-84437) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CALML5 Products

Bioinformatics Tool for CALML5 Antibody (NBP1-84437)

Discover related pathways, diseases and genes to CALML5 Antibody (NBP1-84437). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CALML5 Antibody (NBP1-84437)

Discover more about diseases related to CALML5 Antibody (NBP1-84437).
 

Pathways for CALML5 Antibody (NBP1-84437)

View related products by pathway.

Blogs on CALML5

There are no specific blogs for CALML5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CALML5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CALML5