TPGS2 Antibody

Images

 
Western Blot: TPGS2 Antibody [NBP1-85062] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: TPGS2 Antibody [NBP1-85062] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TPGS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFSMYKPITYNTNLLTEETDSFVNKLDPSKVFKSKNKIVIPK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPGS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TPGS2 Protein (NBP1-85062PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TPGS2 Antibody

  • chromosome 18 open reading frame 10
  • DKFZp586M1523
  • HsT3006
  • L17
  • PGs2
  • tubulin polyglutamylase complex subunit 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7158
Species: Hu, Mu
Applications: WB, IHC
NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006192-P01
Species: Hu
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13251
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06069
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-06930
Species: Hu
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-92350
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13262
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20210
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84744
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TPGS2 Antibody (NBP1-85062) (0)

There are no publications for TPGS2 Antibody (NBP1-85062).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TPGS2 Antibody (NBP1-85062) (0)

There are no reviews for TPGS2 Antibody (NBP1-85062). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TPGS2 Antibody (NBP1-85062) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TPGS2 Products

Bioinformatics Tool for TPGS2 Antibody (NBP1-85062)

Discover related pathways, diseases and genes to TPGS2 Antibody (NBP1-85062). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TPGS2

There are no specific blogs for TPGS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TPGS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TPGS2