60S ribosomal protein L23 Antibody


Western Blot: 60S ribosomal protein L23 Antibody [NBP1-87847] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: 60S ribosomal protein L23 Antibody [NBP1-87847] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: 60S ribosomal protein L23 Antibody [NBP1-87847] - Staining of human breast shows strong cytoplasmic positivity in glandular cells.
Western Blot: 60S ribosomal protein L23 Antibody [NBP1-87847] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

60S ribosomal protein L23 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGV
Specificity of human, mouse, rat 60S ribosomal protein L23 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
60S ribosomal protein L23 Protein (NBP1-87847PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for 60S ribosomal protein L23 Antibody

  • MGC111167
  • MGC117346
  • MGC72008,60S ribosomal protein L17,60S ribosomal protein L23
  • ribosomal protein L17
  • ribosomal protein L23
  • rpL17


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP

Publications for 60S ribosomal protein L23 Antibody (NBP1-87847) (0)

There are no publications for 60S ribosomal protein L23 Antibody (NBP1-87847).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 60S ribosomal protein L23 Antibody (NBP1-87847) (0)

There are no reviews for 60S ribosomal protein L23 Antibody (NBP1-87847). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for 60S ribosomal protein L23 Antibody (NBP1-87847) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for 60S ribosomal protein L23 Antibody (NBP1-87847)

Discover related pathways, diseases and genes to 60S ribosomal protein L23 Antibody (NBP1-87847). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 60S ribosomal protein L23 Antibody (NBP1-87847)

Discover more about diseases related to 60S ribosomal protein L23 Antibody (NBP1-87847).

Pathways for 60S ribosomal protein L23 Antibody (NBP1-87847)

View related products by pathway.

PTMs for 60S ribosomal protein L23 Antibody (NBP1-87847)

Learn more about PTMs related to 60S ribosomal protein L23 Antibody (NBP1-87847).

Blogs on 60S ribosomal protein L23

There are no specific blogs for 60S ribosomal protein L23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our 60S ribosomal protein L23 Antibody and receive a gift card or discount.


Gene Symbol RPL23