RBM26 Antibody - BSA Free

Western Blot: RBM26 Antibody [NBP3-35313] - Western blot analysis of various lysates using RBM26 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RBM26 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 65-140 of human RBM26 (NP_071401.3).
  
  Sequence:
  TQIFVEKLFDAVNTKSYLPPPEQPSSGSLKVEFFPHQEKDIKKEEITKEEEREKKFSRRLNHSPPQSSSRYRENRS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBM26
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 114 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for RBM26 Antibody - BSA Free

• acidic rich RS domain containing 2
• ARRS2
• C13orf10
• chromosome 13 open reading frame 10
• CTCL tumor antigen se70-2
• cutaneous T-cell lymphoma tumor antigen se70-2
• FLJ20957
• MGC133295
• MGC133296
• PRO1777
• RNA binding motif protein 26
• RNA-binding motif protein 26
• RNA-binding protein 26
• RP11-255E21.1
• SE70-2
• ZC3H17

Background

RBM26 (RNA binding motif protein 26) bears two RNA recognition motif (RRM) domains and a C3H1-type zinc finger. The function of RBM26 has not been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RBM26