RAX2 Antibody - BSA Free

Immunohistochemistry-Paraffin: RAX2 Antibody [NBP2-33654] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RAX2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RAX2 Antibody - BSA Free (NBP2-33654) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAX2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RAX2 Protein (NBP2-33654PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RAX2 Antibody - BSA Free

• CORD11
• MGC15631
• QRXQ50-type retinal homeobox protein
• RAXL1ARMD6
• retina and anterior neural fold homeobox 2
• retina and anterior neural fold homeobox like 1
• retina and anterior neural fold homeobox protein 2
• Retina and anterior neural fold homeobox-like protein 1

Background

RAX2 encodes a homeodomain-containing protein that plays a role in eye development. Mutation of this gene causes age-related macular degeneration type 6, an eye disorder resulting in accumulations of protein and lipid beneath the retinal pigment epithelium and within the Bruch's membrane. Defects in this gene can also cause cone-rod dystrophy type 11, a disease characterized by the initial degeneration of cone photoreceptor cells and resulting in loss of color vision and visual acuity, followed by the degeneration of rod photoreceptor cells, which progresses to night blindness and the loss of peripheral vision. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAX2
• Uniprot:
  • Q96IS3(Human)