DLX5 Antibody

Images

 
Western Blot: DLX5 Antibody [NBP1-85793] - Analysis in human cell line Saos-2.
Immunocytochemistry/ Immunofluorescence: DLX5 Antibody [NBP1-85793] - Staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: DLX5 Antibody [NBP1-85793] - Staining of human uterus shows moderate to strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DLX5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKP
Specificity
Specificity of human DLX5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DLX5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF reactivity reported in scientific literature (PMID: 23435261).
Control Peptide
DLX5 Protein (NBP1-85793PEP)
Publications
Read Publication using NBP1-85793.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DLX5 Antibody

  • distal-less homeo box 5
  • distal-less homeobox 5
  • DLX5
  • homeobox protein DLX-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NBP1-85929
Species: Hu
Applications: WB, IHC, IHC-P
MAB7547
Species: Hu
Applications: WB, ICC
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
H00001746-M06
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
H00001745-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-85793
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DLX5 Antibody (NBP1-85793)(1)

Reviews for DLX5 Antibody (NBP1-85793) (0)

There are no reviews for DLX5 Antibody (NBP1-85793). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DLX5 Antibody (NBP1-85793) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DLX5 Antibody (NBP1-85793)

Discover related pathways, diseases and genes to DLX5 Antibody (NBP1-85793). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DLX5 Antibody (NBP1-85793)

Discover more about diseases related to DLX5 Antibody (NBP1-85793).
 

Pathways for DLX5 Antibody (NBP1-85793)

View related products by pathway.

PTMs for DLX5 Antibody (NBP1-85793)

Learn more about PTMs related to DLX5 Antibody (NBP1-85793).
 

Research Areas for DLX5 Antibody (NBP1-85793)

Find related products by research area.

Blogs on DLX5

There are no specific blogs for DLX5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DLX5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DLX5
Entrez