![Western Blot: DLX5 Antibody [NBP1-85793] - Analysis in human cell line Saos-2.](http://images.novusbio.com/fullsize2/DLX5-Antibody-Western-Blot-NBP1-85793-img0006.jpg "Western Blot: DLX5 Antibody [NBP1-85793] - Analysis in human cell line Saos-2.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKP |
| Specificity | Specificity of human DLX5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Predicted Species | Mouse (93%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DLX5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF reactivity reported in scientific literature (PMID: 23435261). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-85793 | Applications | Species |
|---|---|---|
| Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013 Apr [PMID: 23435261] |
Secondary Antibodies |
Isotype Controls |
Diseases for DLX5 Antibody (NBP1-85793)Discover more about diseases related to DLX5 Antibody (NBP1-85793).
| Pathways for DLX5 Antibody (NBP1-85793)View related products by pathway.
|
PTMs for DLX5 Antibody (NBP1-85793)Learn more about PTMs related to DLX5 Antibody (NBP1-85793).
| Research Areas for DLX5 Antibody (NBP1-85793)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DLX5 |
![Immunocytochemistry/Immunofluorescence: DLX5 Antibody [NBP1-85793] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/DLX5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85793-img0010.jpg "Immunocytochemistry/Immunofluorescence: DLX5 Antibody [NBP1-85793] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: DLX5 Antibody [NBP1-85793] - Staining of human uterus shows moderate to strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize2/DLX5-Antibody-Immunohistochemistry-Paraffin-NBP1-85793-img0009.jpg "Immunohistochemistry-Paraffin: DLX5 Antibody [NBP1-85793] - Staining of human uterus shows moderate to strong nuclear positivity in glandular cells.")
![Immunocytochemistry/Immunofluorescence: RUNX2/CBFA1 Antibody [NBP1-77461] - RUNX2 antibody was tested in HeLa cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).](http://images.novusbio.com/fullsize2/RUNX2-CBFA1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-77461-img0007.jpg)
![Immunohistochemistry: RUNX2/CBFA1 Antibody [NBP1-77461] - Staining of RUNX2 in mouse prostate using DAB with hematoxylin counterstain.](http://images.novusbio.com/fullsize2/RUNX2-CBFA1-Antibody-Immunohistochemistry-NBP1-77461-img0006.jpg)
![Immunohistochemistry-Paraffin: Dlx6 Antibody [NBP1-85929] - Staining of human nasopharynx shows moderate nuclear positivity in respiratory epithelial cells.](http://images.novusbio.com/fullsize2/Dlx6-Antibody-Immunohistochemistry-Paraffin-NBP1-85929-img0006.jpg)
![Western Blot: MSX2 Antibody [NBP1-85445] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize2/MSX2-Antibody-Western-Blot-NBP1-85445-img0008.jpg)
![Immunohistochemistry-Paraffin: MSX2 Antibody [NBP1-85445] - Staining of human placenta shows distinct nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize2/MSX2-Antibody-Immunohistochemistry-Paraffin-NBP1-85445-img0009.jpg)
![Western Blot: MSX2 Antibody [NBP1-85445] - Analysis in human cell line BEWO.](http://images.novusbio.com/fullsize2/MSX2-Antibody-Western-Blot-NBP1-85445-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: DLX2 Antibody [NBP2-54963] - Staining of human cell line U-2 OS shows localization to nuclear speckles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/DLX2 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-54963-img0001.jpg)
![Western Blot: MeCP2 Antibody [NB100-56326] - Analysis of MeCP2 in HeLa cell lysate using this antibody.](http://images.novusbio.com/fullsize2/MeCP2 Antibody-Western Blot-NB100-56326-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: MeCP2 Antibody [NB100-56326] - This antibody was tested in A431 cells at a 1:200 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 568 (Red) and DAPI (Blue), respectively.](http://images.novusbio.com/fullsize2/MeCP2-Antibody-Immunocytochemistry-Immunofluorescence-NB100-56326-img0003.jpg)
![Immunohistochemistry-Paraffin: MeCP2 Antibody [NB100-56326] - Mouse liver tissue using this antibody at 1:500 dilution. The antibody generated a very strong/specific nuclear staining with weak to negligible cytoplasmic signal in the hepatocytes, kupffer cells, and in the endothelial cells of blood vessels.](http://images.novusbio.com/fullsize2/MeCP2-Antibody-Immunohistochemistry-Paraffin-NB100-56326-img0007.jpg)
![Western Blot: ASRGL1 Antibody [NBP1-89133] - Analysis in control (vector only transfected HEK293T lysate) and ASRGL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/ASRGL1-Antibody-Western-Blot-NBP1-89133-img0011.jpg)
![Immunocytochemistry/Immunofluorescence: ASRGL1 Antibody [NBP1-89133] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & microtubules. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/ASRGL1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89133-img0004.jpg)
![Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP1-89133] - Staining of human cervix, uterine, endometrium, fallopian tube and skeletal muscle using Anti-ASRGL1 antibody NBP1-89133 (A) shows similar protein distribution across tissues to independent antibody NBP2-38759 (B).](http://images.novusbio.com/fullsize2/ASRGL1-Antibody-Immunohistochemistry-Paraffin-NBP1-89133-img0012.jpg)
![Western Blot: Alkaline Phosphatase, Placental Antibody (8B6) [NB110-3638] - Analysis of Alkaline Phosphatase (Placental) expression in JAR whole cell lysate.](http://images.novusbio.com/fullsize2/Alkaline-Phosphatase--Placental-Antibody-(8B6)-Western-Blot-NB110-3638-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Alkaline Phosphatase/ALPP Antibody (8B6) [NB110-3638] - analysis of ALPP in MDA-MB-231 cells using an anti-ALPP antibody (blue - cell membrane, green - ALPP). Image from verified customer review.](http://images.novusbio.com/fullsize2/Alkaline-Phosphatase-ALPP-Antibody-(8B6)-Immunocytochemistry-Immunofluorescence-NB110-3638-img0003.jpg)
![Immunohistochemistry-Paraffin: Alkaline Phosphatase, Placental Antibody (8B6) [NB110-3638] - IHC staining of Alkaline Phosphatase (Placental) in human placenta using DAB with hematoxylin counterstain. Proteolytic Induced Epitope Retrieval (PIER) was used.](http://images.novusbio.com/fullsize2/Alkaline-Phosphatase--Placental-Antibody-(8B6)-Immunohistochemistry-Paraffin-NB110-3638-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: ATRNL1 Antibody [NBP1-89131] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.](http://images.novusbio.com/fullsize2/ATRNL1 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89131-img0005.jpg)
![Immunohistochemistry-Paraffin: ATRNL1 Antibody [NBP1-89131] - Staining of human small intestine shows strong cytoplasmic and membranous positivity.](http://images.novusbio.com/fullsize2/ATRNL1-Antibody-Immunohistochemistry-Paraffin-NBP1-89131-img0004.jpg)
![Immunohistochemistry: ATRNL1 Antibody [NBP1-89131] - Staining of human small intestine shows strong cytoplasmic and membranous positivity.](http://images.novusbio.com/fullsize2/ATRNL1-Antibody-Immunohistochemistry-NBP1-89131-img0002.jpg)
![Western Blot: NAT10 Antibody [NBP2-32263] - Samples: Whole cell lysate (50 ug) prepared using NETN buffer from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells. Antibodies: Affinity purified rabbit anti-NAT10 antibody NBP2-32263 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.](http://images.novusbio.com/fullsize2/NAT10-Antibody-Western-Blot-NBP2-32263-img0001.jpg)
![Immunohistochemistry: NAT10 Antibody [NBP2-32263] - Sample: FFPE section of mouse plasmacytoma. Antibody: Affinity purified rabbit anti- NAT10 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB. Counterstain: IHC Hematoxylin (blue).](http://images.novusbio.com/fullsize2/NAT10-Antibody-Immunohistochemistry-NBP2-32263-img0004.jpg)
![Immunohistochemistry: NAT10 Antibody [NBP2-32263] - Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti- NAT10 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB. Counterstain: IHC Hematoxylin (blue).](http://images.novusbio.com/fullsize2/NAT10-Antibody-Immunohistochemistry-NBP2-32263-img0003.jpg)
![Immunohistochemistry-Paraffin: PDLIM3 Antibody [NBP1-89134] - Staining in human skeletal muscle and cerebral cortex tissues using anti-PDLIM3 antibody. Corresponding PDLIM3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/PDLIM3-Antibody-Immunohistochemistry-Paraffin-NBP1-89134-img0008.jpg)
![Immunohistochemistry-Paraffin: PDLIM3 Antibody [NBP1-89134] - Staining of human cerebral cortex shows low expression as expected.](http://images.novusbio.com/fullsize2/PDLIM3-Antibody-Immunohistochemistry-Paraffin-NBP1-89134-img0006.jpg)
![Immunohistochemistry-Paraffin: PDLIM3 Antibody [NBP1-89134] - Staining of human skeletal muscle shows high expression.](http://images.novusbio.com/fullsize2/PDLIM3-Antibody-Immunohistochemistry-Paraffin-NBP1-89134-img0007.jpg)
![Western Blot: Dlx1 Antibody (2H3) [H00001745-M01] - Western Blot analysis of DLX1 expression in Raw 264.7 ( Cat # L024V1 ).](http://images.novusbio.com/fullsize2/Dlx1-Antibody-(2H3)-Western-Blot-H00001745-M01-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Dlx1 Antibody (2H3) [H00001745-M01] - Analysis of monoclonal antibody to DLX1 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize2/Dlx1-Antibody-(2H3)-Immunocytochemistry-Immunofluorescence-H00001745-M01-img0006.jpg)
![Western Blot: Dlx1 Antibody (2H3) [H00001745-M01] - Western Blot analysis of DLX1 expression in IMR-32 ( Cat # L008V1 ).](http://images.novusbio.com/fullsize2/Dlx1-Antibody-(2H3)-Western-Blot-H00001745-M01-img0001.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")