Home » DLX5 » Dlx5 Antibodies » DLX5 Antibody

DLX5 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: DLX5 Antibody [NBP1-85793] - Analysis in human cell line Saos-2.
Western Blot: DLX5 Antibody [NBP1-85793] - Analysis in human cell line Saos-2.
Immunocytochemistry/ Immunofluorescence: DLX5 Antibody [NBP1-85793] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DLX5 Antibody [NBP1-85793] - Staining of human uterus shows moderate to strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

DLX5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKP
Specificity
Specificity of human DLX5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DLX5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF reactivity reported in scientific literature (PMID: 23435261).
Control Peptide
DLX5 Protein (NBP1-85793PEP)
Publications
Read Publication using NBP1-85793.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DLX5 Antibody

  • distal-less homeo box 5
  • distal-less homeobox 5
  • DLX5
  • homeobox protein DLX-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RUNX2/CBFA1
Antibody
NBP1-77461
Immunocytochemistry/Immunofluorescence: RUNX2/CBFA1 Antibody [NBP1-77461] - RUNX2 antibody was tested in HeLa cells with FITC (green). Nuclei and alpha-tubulin were counterstained with Dapi (blue) and Dylight 550 (red).
Immunohistochemistry: RUNX2/CBFA1 Antibody [NBP1-77461] - Staining of RUNX2 in mouse prostate using DAB with hematoxylin counterstain.
(6 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
BMP-2
[Unconjugated]
355-BM/CF
BMP-2 [Unconjugated]
(121 Publications)
Species: Hu, Mu, Rt
Dlx6 Antibody
NBP1-85929
Immunohistochemistry-Paraffin: Dlx6 Antibody [NBP1-85929] - Staining of human nasopharynx shows moderate nuclear positivity in respiratory epithelial cells.
(2 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
Osterix/Sp7
Antibody (764704)
MAB7547
Western blot shows lysates of Saos‑2 human osteosarcoma cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human Osterix/Sp7 Monoclonal Antibody (Catalog # MAB7547) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for Osterix/Sp7 at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Osterix/Sp7 was detected in immersion fixed Saos‑2 human osteosarcoma cell line using Mouse Anti-Human Osterix/Sp7 Monoclonal Antibody (Catalog # MAB7547) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red, upper panel; Catalog # NL007) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: WB, ICC
MSX2 Antibody
NBP1-85445
Western Blot: MSX2 Antibody [NBP1-85445] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: MSX2 Antibody [NBP1-85445] - Staining of human placenta shows distinct nuclear positivity in trophoblastic cells.
Western Blot: MSX2 Antibody [NBP1-85445] - Analysis in human cell line BEWO.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Osteocalcin
Antibody (190125)
MAB1419
Osteocalcin was detected in immersion fixed paraffin-embedded sections of human osteosarcoma using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Osteocalcin was detected in immersion fixed MG‑63 human osteosarcoma cell line using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Osteocalcin was detected in immersion fixed rat osteocytes differentiated from mesenchymal stem cells using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Reviews)
(18 Publications)
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
IBSP/Sialoprotein
II
4014-SP
IBSP/Sialoprotein II
(2 Publications)
Species: Hu
DLX2 Antibody (2C8)
H00001746-M06
Western Blot: DLX2 Antibody (2C8) [H00001746-M06] - Analysis of DLX2 expression in NIH/3T3 (Cat # L018V1).
Immunohistochemistry-Paraffin: DLX2 Antibody (2C8) [H00001746-M06] - Analysis of monoclonal antibody to DLX2 on formalin-fixed paraffin-embedded human esophagus. Antibody concentration 1 ug/ml
ELISA: DLX2 Antibody (2C8) [H00001746-M06] - Detection limit for recombinant GST tagged DLX2 is approximately 1ng/ml as a capture antibody.
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
BMP-4
[Unconjugated]
314-BP
1 ug/lane of Recombinant Human BMP-4 was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 22-25 kDa and 37-41 kDa, respectively. Multiple bands in gel are due to variable glycosylation. 
Recombinant Human BMP-4 (Catalog #314-BP/CF) induces alkaline phosphatase production in the ATDC5 mouse chondrogenic cell line. The ED50 for this effect is 2.5-15 ng/mL.
(3 Reviews)
(282 Publications)
Species: Hu
MeCP2 Antibody
NB100-56326
Western Blot: MeCP2 Antibody [NB100-56326] - Analysis of MeCP2 in HeLa cell lysate using this antibody.
Immunocytochemistry/Immunofluorescence: MeCP2 Antibody [NB100-56326] - MeCP2 antibody was tested in A431 cells at a 1:200 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 568 (Red) and DAPI (Blue), respectively.
Immunohistochemistry-Paraffin: MeCP2 Antibody [NB100-56326] - Mouse liver tissue using MeCP2 antibody at 1:500 dilution. The antibody generated a very strong/specific nuclear staining with weak to negligible cytoplasmic signal in the hepatocytes, kupffer cells, and in the endothelial cells of blood vessels.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
ASRGL1 Antibody
NBP1-89133
Immunocytochemistry/Immunofluorescence: ASRGL1 Antibody [NBP1-89133] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP1-89133] - Analysis in human fallopian tube and skeletal muscle tissues. Corresponding ASRGL1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP1-89133] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Alkaline
Phosphatase/ALPP Anti ...
NB110-3638
Western Blot: Alkaline Phosphatase, Placental Antibody (8B6) [NB110-3638] - Analysis of Alkaline Phosphatase (Placental) expression in JAR whole cell lysate.
Immunocytochemistry/Immunofluorescence: Alkaline Phosphatase/ALPP Antibody (8B6) [NB110-3638] - analysis of ALPP in MDA-MB-231 cells using an anti-ALPP antibody (blue - cell membrane, green - ALPP). Image from verified customer review.
Immunohistochemistry-Paraffin: Alkaline Phosphatase, Placental Antibody (8B6) [NB110-3638] - IHC staining of Alkaline Phosphatase (Placental) in human placenta using DAB with hematoxylin counterstain. Proteolytic Induced Epitope Retrieval (PIER) was used.
(1 Review)
(10 Publications)
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
ATRNL1 Antibody
NBP1-89131
Immunocytochemistry/Immunofluorescence: ATRNL1 Antibody [NBP1-89131] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: ATRNL1 Antibody [NBP1-89131] - Staining of human small intestine shows strong cytoplasmic and membranous positivity.
Immunohistochemistry: ATRNL1 Antibody [NBP1-89131] - Staining of human small intestine shows strong cytoplasmic and membranous positivity.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NAT10 Antibody
NBP2-32263
Western Blot: NAT10 Antibody [NBP2-32263] - Samples: Whole cell lysate (50 ug) prepared using NETN buffer from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells. Antibodies: Affinity purified rabbit anti-NAT10 antibody NBP2-32263 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry: NAT10 Antibody [NBP2-32263] - Sample: FFPE section of mouse plasmacytoma. Antibody: Affinity purified rabbit anti- NAT10 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB. Counterstain: IHC Hematoxylin (blue).
Immunohistochemistry: NAT10 Antibody [NBP2-32263] - Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti- NAT10 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB. Counterstain: IHC Hematoxylin (blue).
Species: Hu
Applications: WB, IHC, IP
PDLIM3 Antibody
NBP1-89134
Immunocytochemistry/Immunofluorescence: PDLIM3 Antibody [NBP1-89134] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: PDLIM3 Antibody [NBP1-89134] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: PDLIM3 Antibody [NBP1-89134] - Staining of human cerebral cortex shows low expression as expected.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
BMP-2
[Unconjugated]
355-BM/CF
BMP-2 [Unconjugated]
(121 Publications)
Species: Hu, Mu, Rt
Dlx1 Antibody (2H3)
H00001745-M01
Western Blot: Dlx1 Antibody (2H3) [H00001745-M01] - Western Blot analysis of DLX1 expression in Raw 264.7 ( Cat # L024V1 ).
Immunocytochemistry/Immunofluorescence: Dlx1 Antibody (2H3) [H00001745-M01] - Analysis of monoclonal antibody to DLX1 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: Dlx1 Antibody (2H3) [H00001745-M01] - Western Blot analysis of DLX1 expression in IMR-32 ( Cat # L008V1 ).
(2 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
DLX5 Antibody
NBP1-85793
DLX5 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DLX5 Antibody (NBP1-85793)(1)


Reviews for DLX5 Antibody (NBP1-85793) (0)

There are no reviews for DLX5 Antibody (NBP1-85793). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DLX5 Antibody (NBP1-85793) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DLX5 Antibody (NBP1-85793)

Discover related pathways, diseases and genes to DLX5 Antibody (NBP1-85793). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DLX5 Antibody (NBP1-85793)

Discover more about diseases related to DLX5 Antibody (NBP1-85793).
 

Pathways for DLX5 Antibody (NBP1-85793)

View related products by pathway.

PTMs for DLX5 Antibody (NBP1-85793)

Learn more about PTMs related to DLX5 Antibody (NBP1-85793).
 

Research Areas for DLX5 Antibody (NBP1-85793)

Find related products by research area.

Blogs on DLX5

There are no specific blogs for DLX5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DLX5 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol DLX5
Entrez