RASSF7 Antibody


Immunocytochemistry/ Immunofluorescence: RASSF7 Antibody [NBP2-58860] - Staining of human cell line A-431 shows localization to microtubule organizing center.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

RASSF7 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QATCGQFASDVQFVLRRTGPSLAGRPSSDSCPPPERCLIRASLPVKPRAALGCEPRKTLTPEPAPSLSRPGP
Specificity of human RASSF7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RASSF7 Recombinant Protein Antigen (NBP2-58860PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for RASSF7 Antibody

  • chromosome 11 open reading frame 13
  • HRAS1-related cluster protein 1
  • HRAS1-related cluster-1
  • HRC1C11orf13HRAS1
  • MGC126069
  • MGC126070
  • Ras association (RalGDS/AF-6) domain family (N-terminal) member 7
  • Ras association (RalGDS/AF-6) domain family 7
  • ras association domain-containing protein 7


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC, IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
Species: Hu
Applications: ICC/IF

Publications for RASSF7 Antibody (NBP2-58860) (0)

There are no publications for RASSF7 Antibody (NBP2-58860).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASSF7 Antibody (NBP2-58860) (0)

There are no reviews for RASSF7 Antibody (NBP2-58860). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RASSF7 Antibody (NBP2-58860) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for RASSF7 Antibody (NBP2-58860)

Discover related pathways, diseases and genes to RASSF7 Antibody (NBP2-58860). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASSF7 Antibody (NBP2-58860)

Discover more about diseases related to RASSF7 Antibody (NBP2-58860).

Pathways for RASSF7 Antibody (NBP2-58860)

View related products by pathway.

PTMs for RASSF7 Antibody (NBP2-58860)

Learn more about PTMs related to RASSF7 Antibody (NBP2-58860).

Blogs on RASSF7

There are no specific blogs for RASSF7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RASSF7 Antibody and receive a gift card or discount.


Gene Symbol RASSF7