RASEF Antibody (7L8S8)

Western Blot: RASEF Antibody (7L8S8) [NBP3-33294] - Western blot analysis of various lysates, using RASEF Rabbit mAb at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

Western Blot: RASEF Antibody (7L8S8) [NBP3-33294] - Western blot analysis of various lysates, using RASEF Rabbit mAb at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 60s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clone: 7L8S8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

RASEF Antibody (7L8S8) Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human RASEF (NP_689786.2).
  
  Sequence:
  MEADGDGEELARLRSVFAACDANRSGRLEREEFRALCTELRVRPADAEAVFQRLDADRDGAITFQEFARGFLGSLRGGRRRDWGPLDPAPAVSEAGPETHDSEEDEGDEDAAAALATSCG
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: RASEF
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 83 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RASEF Antibody (7L8S8)

• FLJ31614
• RAB45
• RAB45, member RAS oncogene family
• RAS and EF hand domain containing
• RAS and EF-hand domain containing
• ras and EF-hand domain-containing protein
• Ras-related protein Rab-45

Background

RASEF binds predominantly GDP, and also GTP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RASEF