AIMP2 Antibody

Images

 
Western Blot: AIMP2 Antibody [NBP1-81575] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: AIMP2 Antibody [NBP1-81575] - Staining of human cell line A549 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: AIMP2 Antibody [NBP1-81575] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Western Blot: AIMP2 Antibody [NBP1-81575] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: AIMP2 Antibody [NBP1-81575] - Staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: AIMP2 Antibody [NBP1-81575] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: AIMP2 Antibody [NBP1-81575] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AIMP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: APLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNAL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AIMP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AIMP2 Protein (NBP1-81575PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AIMP2 Antibody

  • aminoacyl tRNA synthase complex-interacting multifunctional protein 2
  • aminoacyl tRNA synthetase complex-interacting multifunctional protein 2
  • ARS-interacting multi-functional protein 2
  • JTV1JTV-1
  • Multisynthase complex auxiliary component p38
  • multisynthetase complex auxiliary component p38
  • P38
  • PRO0992
  • Protein JTV-1

Background

The JTV1 gene is located on chromosome 7p22 flanked by two genes, HRI and PMS2. JTV1 and HRI overlap slightly and are arranged in a tail-to-tail fashion. JTV1 and PMS2 are separated by approximately 200 base pairs and are arranged head-to-head. JTV1 is transcribed in the opposite direction compared to HRI and PMS2. The function of the JTV1 gene product is unknown. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AIMP2 Antibody (NBP1-81575) (0)

There are no publications for AIMP2 Antibody (NBP1-81575).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AIMP2 Antibody (NBP1-81575) (0)

There are no reviews for AIMP2 Antibody (NBP1-81575). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AIMP2 Antibody (NBP1-81575) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AIMP2 Products

Research Areas for AIMP2 Antibody (NBP1-81575)

Find related products by research area.

Blogs on AIMP2

There are no specific blogs for AIMP2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AIMP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AIMP2