GKAP1 Antibody

Images

 
Western Blot: GKAP1 Antibody [NBP1-84669] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: GKAP1 Antibody [NBP1-84669] - Staining of human cell line U-2 OS shows localization to cytosol & microtubule organizing center.
Immunohistochemistry-Paraffin: GKAP1 Antibody [NBP1-84669] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cell.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GKAP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KNHQGKDRPLTVSLKDFHSEDHISKKTEELSSSQTLSHDGGFFNRLEDDVHKILIREKRREQLTEYNGTDNCTAHEHNQALVLKDG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GKAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GKAP1 Protein (NBP1-84669PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GKAP1 Antibody

  • cGMP-dependent protein kinase-anchoring protein of 42 kDa
  • FKSG21
  • FLJ25469
  • G kinase anchoring protein 1
  • G kinase-anchoring protein 1
  • GKAP42cGMP-dependent protein kinase anchoring protein 42kDa
  • protein kinase anchoring protein GKAP42

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02521
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02023
Species: Hu
Applications: WB, ICC/IF
NBP1-84418
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55699
Species: Hu
Applications: WB, ICC/IF
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88751
Species: Hu
Applications: IHC, IHC-P
NB100-1720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
H00158158-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-56536
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30975
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33879
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46134
Species: Hu
Applications: WB, Flow, IHC, IF
NBP2-15140
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84669
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GKAP1 Antibody (NBP1-84669) (0)

There are no publications for GKAP1 Antibody (NBP1-84669).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GKAP1 Antibody (NBP1-84669) (0)

There are no reviews for GKAP1 Antibody (NBP1-84669). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GKAP1 Antibody (NBP1-84669) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GKAP1 Products

Bioinformatics Tool for GKAP1 Antibody (NBP1-84669)

Discover related pathways, diseases and genes to GKAP1 Antibody (NBP1-84669). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GKAP1 Antibody (NBP1-84669)

Discover more about diseases related to GKAP1 Antibody (NBP1-84669).
 

Pathways for GKAP1 Antibody (NBP1-84669)

View related products by pathway.

PTMs for GKAP1 Antibody (NBP1-84669)

Learn more about PTMs related to GKAP1 Antibody (NBP1-84669).

Blogs on GKAP1

There are no specific blogs for GKAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GKAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GKAP1