RARRES3 Antibody - BSA Free

Western Blot: RARRES3 Antibody [NBP1-59395] - Titration: 5.0ug/ml Positive Control: HepG2 cell lysate.

Immunohistochemistry-Paraffin: RARRES3 Antibody [NBP1-59395] - Human Stomach Tissue, Epithelial cells of funic gland (Indicated with Arrows) 4-8ug/ml.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

RARRES3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to RARRES3(retinoic acid receptor responder (tazarotene induced) 3) The peptide sequence was selected from the middle region of RARRES3. Peptide sequence FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RARRES3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for RARRES3 Antibody - BSA Free

• HRASLS4
• PLA1/2-3
• RARRES3
• RAR-responsive protein TIG3
• retinoic acid receptor responder (tazarotene induced) 3
• retinoic acid receptor responder protein 3
• retinoic acid-inducible gene 1
• Retinoid-inducible gene 1 protein
• RIG1
• Tazarotene-induced gene 3 protein
• TIG3
• TIG3MGC8906

Background

Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES3 is thought act as a tumor suppressor or growth regulator.Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES1, RARRES2, and RARRES3 are genes whose expression is upregulated by the synthetic retinoid tazarotene. RARRES3 is thought act as a tumor suppressor or growth regulator.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RARRES3 Antibody (NBP1-59395)(1)

Publication using NBP1-59395

• Koh YW, Han JH, Haam S, Lee HW. An immune-related gene expression signature predicts brain metastasis in lung adenocarcinoma patients after surgery: gene expression profile and immunohistochemical analyses Translational Lung Cancer Research 2021-03-15 [PMID: 33718023] (Immunohistochemistry)

Bioinformatics

• Gene Symbol: RARRES3
• Uniprot:
  • Q9UL19(Human)