DHX58 Antibody

Images

 
Western Blot: DHX58 Antibody [NBP1-85348] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-163
Immunohistochemistry-Paraffin: DHX58 Antibody [NBP1-85348] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DHX58 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQIHDHLEMPELSRKFGTQMYEQQVVKLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DHX58
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DHX58 Protein (NBP1-85348PEP)
Publications
Read Publication using
NBP1-85348 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DHX58 Antibody

  • D11lgp2e
  • D11LGP2probable ATP-dependent RNA helicase DHX58
  • DEXH (Asp-Glu-X-His) box polypeptide 58
  • EC 3.6.4.13
  • LGP2ortholog of mouse D11lgp2
  • Probable ATP-dependent helicase LGP2
  • Protein D11Lgp2 homolog
  • RIG-I-like receptor LGP2
  • RLR
  • RNA helicase LGP2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
AF6139
Species: Hu
Applications: ICC
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP2-42073
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-57578
Species: Hu
Applications: WB
NBP1-85348
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DHX58 Antibody (NBP1-85348)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for DHX58 Antibody (NBP1-85348) (0)

There are no reviews for DHX58 Antibody (NBP1-85348). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DHX58 Antibody (NBP1-85348) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DHX58 Products

Bioinformatics Tool for DHX58 Antibody (NBP1-85348)

Discover related pathways, diseases and genes to DHX58 Antibody (NBP1-85348). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DHX58 Antibody (NBP1-85348)

Discover more about diseases related to DHX58 Antibody (NBP1-85348).
 

Pathways for DHX58 Antibody (NBP1-85348)

View related products by pathway.

PTMs for DHX58 Antibody (NBP1-85348)

Learn more about PTMs related to DHX58 Antibody (NBP1-85348).

Blogs on DHX58

There are no specific blogs for DHX58, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DHX58 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DHX58