DHX58 Antibody

Images

 
Western Blot: DHX58 Antibody [NBP1-85348] - (A) HeLa and (B) C2C12 cells were treated with the indicated siRNAs for 2 days and cellular lysates were subjected to Western blot analysis using anti-rapsyn antibody. GAPDH ...read more
Immunohistochemistry: DHX58 Antibody [NBP1-85348] - Bright-field images of histological muscle sections from individual B.II.2 and a control fetus stained with anti-rapsyn antibodies (brown). Nuclei were visualized by ...read more
Western Blot: DHX58 Antibody [NBP1-85348] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-163
Western Blot: DHX58 Antibody [NBP1-85348] - Rig-I Like Receptor (RLR) gene expression in stable cell lines encompassing ST-RLRs. Western blot analysis was performed using (D) anti-LGP2 in ST-RLR cells. Cells were ...read more
Immunohistochemistry-Paraffin: DHX58 Antibody [NBP1-85348] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Rig-I Like Receptor (RLR) gene expression in stable cell lines encompassing ST-RLRs. (C-F) Analysis of RLR protein expression in ST-RLR cells and efficiency of tagged RLR purification by affinity chromatography. ST-RLR ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DHX58 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQIHDHLEMPELSRKFGTQMYEQQVVKLS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DHX58
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DHX58 Protein (NBP1-85348PEP)
Publications
Read Publication using
NBP1-85348 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DHX58 Antibody

  • D11lgp2e
  • D11LGP2probable ATP-dependent RNA helicase DHX58
  • DEXH (Asp-Glu-X-His) box polypeptide 58
  • EC 3.6.4.13
  • LGP2ortholog of mouse D11lgp2
  • Probable ATP-dependent helicase LGP2
  • Protein D11Lgp2 homolog
  • RIG-I-like receptor LGP2
  • RLR
  • RNA helicase LGP2

Background

Negative regulator of host innate immune defense against viruses. The repressor domain of DHX58 interactswith DDX58 and negatively regulates DDX58-mediated signaling. Binds dsRNA produced during viral replication, inparticuliar HCV RNA. Binding occurs at blunt dsRNA termini

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DHX58 Antibody (NBP1-85348)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for DHX58 Antibody (NBP1-85348) (0)

There are no reviews for DHX58 Antibody (NBP1-85348). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DHX58 Antibody (NBP1-85348) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DHX58 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DHX58