DHX58 Antibody

Western Blot: DHX58 Antibody [NBP1-85348] - (A) HeLa and (B) C2C12 cells were treated with the indicated siRNAs for 2 days and cellular lysates were subjected to Western blot analysis using anti-rapsyn antibody. GAPDH was used as loading control. Rapsyn protein levels are reduced in NUP88-depleted cells. Quantification of the respective expression levels of rapsyn after transfection of HeLa and C2C12 cells with the indicated siRNAs and shRNA-mediated depletion of NUP88 in C2C12 cells. Blots from three independent experiments for each condition were analyzed. Data present mean +/- SEM. P-values: ***<0.001; **<0.01, *<0.05; t-test, one-tailed. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pgen.1007845) licensed under a CC-BY licence.

Immunohistochemistry: DHX58 Antibody [NBP1-85348] - Bright-field images of histological muscle sections from individual B.II.2 and a control fetus stained with anti-rapsyn antibodies (brown). Nuclei were visualized by hematoxylin. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pgen.1007845) licensed under a CC-BY licence.

Western Blot: DHX58 Antibody [NBP1-85348] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-163

Western Blot: DHX58 Antibody [NBP1-85348] - Rig-I Like Receptor (RLR) gene expression in stable cell lines encompassing ST-RLRs. Western blot analysis was performed using (D) anti-LGP2 in ST-RLR cells. Cells were transfected with pIFNB-FLuc, pTK-Rluc and either mock, poly(I:C) or 5'3P. Image collected and cropped by CiteAb from the following publication (//elifesciences.org/articles/11275) licensed under a CC-BY licence.

Immunohistochemistry-Paraffin: DHX58 Antibody [NBP1-85348] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

DHX58 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQIHDHLEMPELSRKFGTQMYEQQVVKLS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DHX58
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 27011352). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DHX58 Protein (NBP1-85348PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DHX58 Antibody

• D11lgp2e
• D11LGP2probable ATP-dependent RNA helicase DHX58
• DEXH (Asp-Glu-X-His) box polypeptide 58
• EC 3.6.4.13
• LGP2ortholog of mouse D11lgp2
• Probable ATP-dependent helicase LGP2
• Protein D11Lgp2 homolog
• RIG-I-like receptor LGP2
• RLR
• RNA helicase LGP2

Background

Negative regulator of host innate immune defense against viruses. The repressor domain of DHX58 interactswith DDX58 and negatively regulates DDX58-mediated signaling. Binds dsRNA produced during viral replication, inparticuliar HCV RNA. Binding occurs at blunt dsRNA termini

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DHX58 Antibody (NBP1-85348)(1)

Publication using NBP1-85348

• David RYS, Combredet C, Sismeiro O. Comparative analysis of viral RNA signatures on different RIG-I-like receptors. Elife. 2016-03-24 [PMID: 27011352] (WB, Human)

Bioinformatics

• Gene Symbol: DHX58