RAPH1 Antibody - BSA Free

Western Blot-RAPH1 Antibody [NBP1-90859] - Analysis in human cell lines Caco-2 and HEK293 using Anti-RAPH1 antibody. Corresponding RAPH1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

Staining of human testis shows moderate cytoplasmic membranous positivity in cells in seminiferous ducts.

Staining of human liver shows moderate cytoplasmic membranous positivity in hepatocytes.

Staining of human placenta shows moderate cytoplasmic membranous positivity in trophoblastic cells.

Staining of human tonsil tissue shows moderate cytoplasmic membranous positivity in non-germinal center cells.

Analysis in human cell lines Caco-2 and HEK293 using Anti-RAPH1 antibody. Corresponding RAPH1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Flow, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RAPH1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NPQPQQWSKMSVKKAPPPTRPKRNDSTRLTQAEISEQPTMATVVPQVPTSPKSSLSVQPGFLADLNRTLQRKSITRHGSLSSRMSRAEPTATMDDMALPPPPPELLSDQQKAGYGGSHISGYATLRRGPPPAPPKRDQNTKLSR
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAPH1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Flow Cytometry Reactivity reported in (PMID: 25517094)
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RAPH1 Protein (NBP1-90859PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RAPH1 Antibody - BSA Free

• candidate 18
• candidate 9
• lamellipodin
• PREL2
• PREL-2
• proline rich EVH1 ligand 2
• Protein RMO1
• Ras association (RalGDS/AF-6) and pleckstrin homology domains 1
• ras-associated and pleckstrin homology domains-containing protein 1
• RMO1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAPH1 Antibody (NBP1-90859)(3)

Publications using NBP1-90859

• Joseph A Brazzo, John C Biber, Erik Nimmer, Yuna Heo, Linxuan Ying, Ruogang Zhao, Kwonmoo Lee, Matthias Krause, Yongho Bae Mechanosensitive expression of lamellipodin promotes intracellular stiffness, cyclin expression and cell proliferation. Journal of cell science 2021-07-12 [PMID: 34152388]
• Iii JAB, Biber JC, Nimmer E et al. Mechanosensitive expression of lamellipodin promotes intracellular stiffness, cyclin expression, and cell proliferation Journal of cell science 2021-05-25 [PMID: 34031693]
• Emmanuel Boucrot, Antonio P. A. Ferreira, Leonardo Almeida-Souza et al. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2014-12-17 [PMID: 25517094] (FLOW, WB, Human)

Bioinformatics

• Gene Symbol: RAPH1