Rad1 Antibody

Images

 
Western Blot: Rad1 Antibody [NBP2-13196] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Rad1 Antibody [NBP2-13196] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: Rad1 Antibody [NBP2-13196] - Staining of human urinary bladder shows moderate nuclear positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Rad1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GLREAFSELDMTSEVLQITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLME AFHCNQTQVNRYKISLLKPSTKALVLSCKVSIRTDNRGFLSLQYMIRNED GQICFVEYYCCPDEEVPESES
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Control Peptide
Rad1 Protein (NBP2-13196PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Rad1 Antibody

  • cell cycle checkpoint protein Hrad1
  • checkpoint control protein HRAD1
  • DNA repair exonuclease rad1 homolog
  • DNA repair exonuclease REC1
  • EC 3.1.11.2
  • exonuclease homolog RAD1
  • HRAD1
  • RAD1 (S. pombe) homolog
  • RAD1 homolog (S. pombe)
  • Rad1-like DNA damage checkpoint protein
  • REC1cell cycle checkpoint protein RAD1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89445
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-58116
Species: Hu
Applications: ICC/IF
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP1-02812
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-621
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Rad1 Antibody (NBP2-13196) (0)

There are no publications for Rad1 Antibody (NBP2-13196).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rad1 Antibody (NBP2-13196) (0)

There are no reviews for Rad1 Antibody (NBP2-13196). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Rad1 Antibody (NBP2-13196) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rad1 Products

Bioinformatics Tool for Rad1 Antibody (NBP2-13196)

Discover related pathways, diseases and genes to Rad1 Antibody (NBP2-13196). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rad1 Antibody (NBP2-13196)

Discover more about diseases related to Rad1 Antibody (NBP2-13196).
 

Pathways for Rad1 Antibody (NBP2-13196)

View related products by pathway.

PTMs for Rad1 Antibody (NBP2-13196)

Learn more about PTMs related to Rad1 Antibody (NBP2-13196).
 

Research Areas for Rad1 Antibody (NBP2-13196)

Find related products by research area.

Blogs on Rad1

There are no specific blogs for Rad1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rad1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD1