![Western Blot: RAC3 Antibody [NBP2-32058] - Analysis in human cell line RT-4.](http://images.novusbio.com/fullsize/RAC3-Antibody-Western-Blot-NBP2-32058-img0009.jpg "Western Blot: RAC3 Antibody [NBP2-32058] - Analysis in human cell line RT-4.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit RAC3 Antibody - BSA Free (NBP2-32058) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREI |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAC3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for RAC3 Antibody (NBP2-32058)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: RAC3 Antibody [NBP2-32058] - Staining of human pancreas shows no positivity in exocrine glandular cellas as expected.](http://images.novusbio.com/fullsize/RAC3-Antibody-Immunohistochemistry-Paraffin-NBP2-32058-img0013.jpg "Immunohistochemistry-Paraffin: RAC3 Antibody [NBP2-32058] - Staining of human pancreas shows no positivity in exocrine glandular cellas as expected.")
![Immunohistochemistry-Paraffin: RAC3 Antibody [NBP2-32058] - Staining of human skin shows strong membranous positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/RAC3-Antibody-Immunohistochemistry-Paraffin-NBP2-32058-img0010.jpg "Immunohistochemistry-Paraffin: RAC3 Antibody [NBP2-32058] - Staining of human skin shows strong membranous positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: RAC3 Antibody [NBP2-32058] - Staining of human prostate shows strong membranous positivity in basal cells.](http://images.novusbio.com/fullsize/RAC3-Antibody-Immunohistochemistry-Paraffin-NBP2-32058-img0011.jpg "Immunohistochemistry-Paraffin: RAC3 Antibody [NBP2-32058] - Staining of human prostate shows strong membranous positivity in basal cells.")
![Immunohistochemistry-Paraffin: RAC3 Antibody [NBP2-32058] - Staining of human colon shows weak to moderate membranous/cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/RAC3-Antibody-Immunohistochemistry-Paraffin-NBP2-32058-img0012.jpg "Immunohistochemistry-Paraffin: RAC3 Antibody [NBP2-32058] - Staining of human colon shows weak to moderate membranous/cytoplasmic positivity in glandular cells.")
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")