Recombinant Human RAB8A GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human RAB8A Protein [H00004218-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human RAB8A GST (N-Term) Protein Summary

Description
Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-207 of Human RAB8A

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
RAB8A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
48.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RAB8A GST (N-Term) Protein

  • mel transforming oncogene (derived from cell line NK14)- RAB8 homolog
  • mel transforming oncogene (derived from cell line NK14)
  • MEL
  • MELras-associated protein RAB8
  • Oncogene c-mel
  • RAB8
  • RAB8A
  • RAB8A, member RAS oncogene family
  • RAB8mel transforming oncogene (RAB8 homolog)
  • ras-related protein Rab-8A

Background

The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1. RAB8A( AAH02977, 1 a.a. - 208 a.a.) recombinant protein with GST. PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49320
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NBP1-84682
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-33110
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-23392
Species: Hu
Applications: PAGE, WB
H00005873-M02
Species: Hu, Mu, Rb
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, S-ELISA, WB
NBP1-92309
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45499
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
MAB8306
Species: Hu
Applications: IHC, WB
NBP1-55113
Species: Hu, Pm, Mu
Applications: IHC,  IHC-P, WB
NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P, IP, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP2-57641
Species: Hu
Applications: ICC/IF, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-84793
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P, WB
H00005087-M01
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
H00003043-M02
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB

Publications for RAB8A Recombinant Protein (H00004218-P01) (0)

There are no publications for RAB8A Recombinant Protein (H00004218-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB8A Recombinant Protein (H00004218-P01) (0)

There are no reviews for RAB8A Recombinant Protein (H00004218-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB8A Recombinant Protein (H00004218-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RAB8A Products

Research Areas for RAB8A Recombinant Protein (H00004218-P01)

Find related products by research area.

Blogs on RAB8A

There are no specific blogs for RAB8A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RAB8A GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB8A